S100A11 Protein, Mouse (His)

Customer Review

Based on 1 Customer Validation

The S100A11 protein plays a crucial role in promoting keratinocyte differentiation and keratinization, suggesting its involvement in important processes related to skin development and integrity.As a disulfide-linked homodimer, S100A11 may contribute to the molecular machinery that regulates keratinocyte maturation and specialized functions.S100A11 Protein, Mouse (His) is the recombinant mouse-derived S100A11 protein, expressed by E.coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The S100A11 protein plays a crucial role in promoting keratinocyte differentiation and keratinization, suggesting its involvement in important processes related to skin development and integrity.As a disulfide-linked homodimer, S100A11 may contribute to the molecular machinery that regulates keratinocyte maturation and specialized functions.S100A11 Protein, Mouse (His) is the recombinant mouse-derived S100A11 protein, expressed by E.coli , with N-6*His labeled tag.

Background

S100A11 protein, also known as S100C or calgizzarin, plays a crucial role in the differentiation and cornification processes of keratinocytes, which are the main cells found in the outer layer of the skin. It functions as a homodimer, meaning it forms a complex consisting of two identical subunits. The dimerization occurs through disulfide linkages, where two sulfur atoms form a bond, contributing to the stability and structure of the protein. The S100A11 protein's involvement in keratinocyte differentiation and cornification suggests its significance in maintaining the integrity and barrier function of the skin.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human ANXA2 (HY-P7515) at 0.5 μg/mL (100 μL/well) on the plate can bind Mouse S100A11. The ED50 for this effect is 1.633 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Human ANXA2 (HY-P7515) at 0.5 μg/mL (100 μL/well) on the plate can bind Mouse S100A11. The ED50 for this effect is 1.633 μg/mL.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • S100A11 (M1-I98)
      Accession # P50543
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    S100A11; MLN70; S100 Calcium Binding Protein A11; S100 Calcium-Binding Protein A11 (Calgizzarin); S100C; Epididymis Secretory Protein Li 43; Calgizzarin; S100 Calcium-Binding Protein A11; Metastatic Lymph Node Gene 70 Protein; S100 Calcium-Binding Protein

  • AA Sequence

    MPTETERCIESLIAVFQKYSGKDGNNTQLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDLNCDGQLDFQEFLNLIGGLAIACHDSFIQTSQKRI

  • Predicted Molecular Mass

    12.6 kDa

  • Molecular Weight

    Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00