S100A11 Protein, Mouse (His)
Based on 1 Customer Validation
The S100A11 protein plays a crucial role in promoting keratinocyte differentiation and keratinization, suggesting its involvement in important processes related to skin development and integrity.As a disulfide-linked homodimer, S100A11 may contribute to the molecular machinery that regulates keratinocyte maturation and specialized functions.S100A11 Protein, Mouse (His) is the recombinant mouse-derived S100A11 protein, expressed by E.coli , with N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The S100A11 protein plays a crucial role in promoting keratinocyte differentiation and keratinization, suggesting its involvement in important processes related to skin development and integrity.As a disulfide-linked homodimer, S100A11 may contribute to the molecular machinery that regulates keratinocyte maturation and specialized functions.S100A11 Protein, Mouse (His) is the recombinant mouse-derived S100A11 protein, expressed by E.coli , with N-6*His labeled tag.
Background
S100A11 protein, also known as S100C or calgizzarin, plays a crucial role in the differentiation and cornification processes of keratinocytes, which are the main cells found in the outer layer of the skin. It functions as a homodimer, meaning it forms a complex consisting of two identical subunits. The dimerization occurs through disulfide linkages, where two sulfur atoms form a bond, contributing to the stability and structure of the protein. The S100A11 protein's involvement in keratinocyte differentiation and cornification suggests its significance in maintaining the integrity and barrier function of the skin.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human ANXA2 (HY-P7515) at 0.5 μg/mL (100 μL/well) on the plate can bind Mouse S100A11. The ED50 for this effect is 1.633 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
P50543 (M1-I98)
-
Molecular Construction
-
N-term
-
6*His
-
S100A11 (M1-I98)
Accession # P50543 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
S100A11; MLN70; S100 Calcium Binding Protein A11; S100 Calcium-Binding Protein A11 (Calgizzarin); S100C; Epididymis Secretory Protein Li 43; Calgizzarin; S100 Calcium-Binding Protein A11; Metastatic Lymph Node Gene 70 Protein; S100 Calcium-Binding Protein
-
AA Sequence
MPTETERCIESLIAVFQKYSGKDGNNTQLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDLNCDGQLDFQEFLNLIGGLAIACHDSFIQTSQKRI
-
Predicted Molecular Mass
12.6 kDa
-
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)