1. Recombinant Proteins
  2. Viral Proteins
  3. SARS-CoV-2 Proteins
  4. SARS-CoV-2 Spike Proteins
  5. SARS-CoV-2 S Protein
  6. SARS-CoV-2 S glycoprotein (HEK 293, His, Flag)

SARS-CoV-2 S glycoprotein (HEK 293, His, Flag)

Cat. No.: HY-P72035
Handling Instructions

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
2 μg $80 In-stock
Estimated Time of Arrival: December 31
10 μg $195 In-stock
Estimated Time of Arrival: December 31
50 μg $550 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

SARS-CoV-2 S glycoprotein (HEK 293, His, Flag) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S at 2 μg/mL can bind human ACE2 , the EC50 of SARS-CoV-2-S protein is 56.64 - 103.6 ng/mL. Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S at 2
Species

Virus

Source

HEK293

Tag

N-10*his;C-Flag

Accession

P0DTC2 (V16-R685)

Gene ID
Synonyms
E2 Peplomer protein
AA Sequence

VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR

Molecular Weight

Approximately 79.6 kDa

Purity

Greater than 90% as determined by SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

SARS-CoV-2 S glycoprotein (HEK 293, His, Flag) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SARS-CoV-2 S glycoprotein (HEK 293, His, Flag)
Cat. No.:
HY-P72035
Quantity:
MCE Japan Authorized Agent: