SARS-CoV S Protein (HEK293, His-Myc)

For research use only. We do not sell to patients.

Size	Price	Stock	Quantity
Free Sample		Apply now
2 μg	$78	In-stock	Estimated Time of Arrival: December 31
10 μg	$220	In-stock	Estimated Time of Arrival: December 31
50 μg	$616	In-stock	Estimated Time of Arrival: December 31
100 μg		Get quote
250 μg		Get quote

* Please select Quantity before adding items.

Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 2 μg/mL can bind Paguma larvata ACE2 , the EC50 is 33.37-79.47 ng/mL.
Species	Virus
Source	HEK293
Tag	N-10*His;C-Myc
Accession	P59594 (R306-F527)
Gene ID	1489668 [NCBI]
Synonyms	S glycoprotein; E2; Peplomer protein; Spike protein S1; Spike protein S2;
AA Sequence	RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF
Molecular Weight	Approximately 37 kDa
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Appearance	Lyophilized powder.
Formulation	Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Endotoxin Level	<1 EU/μg, determined by LAL method.
Reconstitution	It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.
Storage & Stability	Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Shipping	Room temperature in continental US;may vary elsewhere.
Documentation	Select Batch: Data Sheet (233 KB) SDS (251 KB) COA (220 KB) Handling Instructions (2659 KB)

SARS-CoV S Protein (HEK293, His-Myc) Related Classifications

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Specific Activity (Unit/mg) = 10⁶ ÷ Biological Activity (ED₅₀)

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.