SCGB2A1 Protein, Human (HEK293, Fc)

The SCGB2A1 protein is a multifunctional binding entity that may interact with androgens, steroids, and the chemotherapy drug estramustine in prostate cancer treatment. Transcriptionally regulated by steroid hormones, suggesting involvement in hormone signaling pathways. SCGB2A1 Protein, Human (HEK293, Fc) is the recombinant human-derived SCGB2A1 protein, expressed by HEK293 , with C-hFc labeled tag.

The SCGB2A1 protein emerges as a versatile binding entity, potentially interacting with androgens, other steroids, and the chemotherapeutic agent estramustine used in prostate cancer treatment. Additionally, it may be subject to transcriptional regulation by steroid hormones, indicating a potential involvement in hormonal signaling pathways. Structurally, SCGB2A1 forms a heterodimer consisting of a lipophilin A and a lipophilin C (mammaglobin B) monomer, arranged in a head-to-head association. The diverse binding capabilities and structural arrangement suggest that SCGB2A1 may play a multifaceted role in hormonal regulation, potentially influencing cellular responses to steroids and chemotherapeutic agents in contexts such as prostate cancer. Further investigation is warranted to unravel the specific contributions of SCGB2A1 to these complex biological processes.

Human

HEK293

C-hFc

O75556/NP_002398.1 (D19-N95)

4246  [NCBI]

Full Length of Mature Protein

DSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN

Approximately 35.6 kDa.

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.