SCGB2A1 Protein, Human (HEK293, Fc)
The SCGB2A1 protein is a multifunctional binding entity that may interact with androgens, steroids, and the chemotherapy drug estramustine in prostate cancer treatment. Transcriptionally regulated by steroid hormones, suggesting involvement in hormone signaling pathways. SCGB2A1 Protein, Human (HEK293, Fc) is the recombinant human-derived SCGB2A1 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The SCGB2A1 protein is a multifunctional binding entity that may interact with androgens, steroids, and the chemotherapy drug estramustine in prostate cancer treatment. Transcriptionally regulated by steroid hormones, suggesting involvement in hormone signaling pathways. SCGB2A1 Protein, Human (HEK293, Fc) is the recombinant human-derived SCGB2A1 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
The SCGB2A1 protein emerges as a versatile binding entity, potentially interacting with androgens, other steroids, and the chemotherapeutic agent estramustine used in prostate cancer treatment. Additionally, it may be subject to transcriptional regulation by steroid hormones, indicating a potential involvement in hormonal signaling pathways. Structurally, SCGB2A1 forms a heterodimer consisting of a lipophilin A and a lipophilin C (mammaglobin B) monomer, arranged in a head-to-head association. The diverse binding capabilities and structural arrangement suggest that SCGB2A1 may play a multifaceted role in hormonal regulation, potentially influencing cellular responses to steroids and chemotherapeutic agents in contexts such as prostate cancer. Further investigation is warranted to unravel the specific contributions of SCGB2A1 to these complex biological processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
O75556/NP_002398.1 (D19-N95)
-
Molecular Construction
-
N-term
-
SCGB2A1 (D19-N95)
Accession # O75556/NP_002398.1 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
SCGB2A1; Lipophilin C; Prev. MGB2; Mammaglobin B; UGB3; Mammaglobin 2; Lacryglobin; Lipophilin-C; LPHC; LIPHC; Mammaglobin-B; LPNC; Mammaglobin-2; Secretoglobin Family 2A Member 1; MGC71973
-
AA Sequence
DSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN
-
Predicted Molecular Mass
35.6 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
