SCN3B Protein, Human (HEK293, Fc)
The SCN3B protein critically affects sodium channel dynamics, inducing unique sustained currents and slower inactivation rates compared to beta-1. Its interaction with NFASC is shown to guide sodium channels to the nodes of Ranvier during axonal development and retain them in mature myelinated axons. SCN3B Protein, Human (HEK293, Fc) is the recombinant human-derived SCN3B protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The SCN3B protein critically affects sodium channel dynamics, inducing unique sustained currents and slower inactivation rates compared to beta-1. Its interaction with NFASC is shown to guide sodium channels to the nodes of Ranvier during axonal development and retain them in mature myelinated axons. SCN3B Protein, Human (HEK293, Fc) is the recombinant human-derived SCN3B protein, expressed by HEK293 , with C-hFc labeled tag.
Background
SCN3B protein plays a crucial role in modulating the kinetics of channel gating, resulting in distinctive persistent sodium currents. In comparison to the beta-1 subunit, SCN3B induces a slower inactivation of sodium channels, influencing their opening dynamics. The interaction of SCN3B with NFASC suggests its potential involvement in directing sodium channels to the nodes of Ranvier during axonal development and retaining them at these nodes in mature myelinated axons. The voltage-sensitive sodium channel, comprising an ion-conducting pore-forming alpha-subunit, is intricately regulated by beta-1, beta-2, beta-3, and/or beta-4 subunits. Notably, beta-1 and beta-3 associate non-covalently with alpha, while beta-2 and beta-4 form covalent bonds through disulfide linkages, contributing to the functional complexity of the sodium channel complex.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q9NY72 (M1-E159)
-
Molecular Construction
-
N-term
-
SCN3B (M1-E159)
Accession # Q9NY72 -
hFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
SCN3B; Sodium Channel, Voltage-Gated, Type III, Beta; Sodium Voltage-Gated Channel Beta Subunit 3; Voltage-Gated Sodium Channel Beta-3 Subunit; Sodium Channel Regulatory Subunit Beta-3; Sodium Channel Subunit Beta-3; HSA243396; KIAA1158; SCNB3; ATFB16; So
-
AA Sequence
MPAFNRLFPLASLVLIYWVSVCFPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFEFEAHRPFVKTTRLIPLRVTEEAGEDFTSVVSE
-
Predicted Molecular Mass
42.5 kDa
-
Molecular Weight
Approximately 50-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
