Serpin A1 Protein, Rat (HEK293, His)
Based on 1 Customer Validation
The serpin A1 protein is a vigilant guardian in cell regulation, effectively inhibiting elastase and providing a strong barrier to its enzymatic activity.Serpin A1 has moderate affinity for plasmin and thrombin and exhibits versatility in binding a range of serine proteases.Serpin A1 Protein, Rat (HEK293, His) is the recombinant rat-derived Serpin A1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The serpin A1 protein is a vigilant guardian in cell regulation, effectively inhibiting elastase and providing a strong barrier to its enzymatic activity.Serpin A1 has moderate affinity for plasmin and thrombin and exhibits versatility in binding a range of serine proteases.Serpin A1 Protein, Rat (HEK293, His) is the recombinant rat-derived Serpin A1 protein, expressed by HEK293 , with C-His labeled tag.
Background
Serpin A1, a vigilant guardian in the intricate landscape of cellular regulation, stands as a potent inhibitor of serine proteases. Its primary target is elastase, where it acts as a formidable shield against enzymatic activity. Moreover, Serpin A1 exhibits a moderate affinity for plasmin and thrombin, showcasing its versatility in engaging with a spectrum of serine proteases. In its regulatory role, Serpin A1 establishes intricate interactions with CELA2A, ERGIC3, LMAN1/ERGIC53, and PRSS1/Trypsin, contributing to the nuanced orchestration of proteolytic processes within the cellular milieu.
Verified Bioactivity
Measured by its ability to inhibit trypsin cleavage of a fluorogenic peptide substrate, Mca-RPKPVE-Nval-WRK(Dnp)-NH2. The IC50 value is 2.931 nM, as measured under the described conditions.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-His
-
Accession
P17475 (E25-R411)
-
Molecular Construction
-
N-term
-
Serpin A1 (E25-R411)
Accession # P17475 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
SERPINA1; Serpin A1; Prev. PI; Serpin Peptidase Inhibitor, Clade A (Alpha-1 Antiproteinase, Antitrypsin), Member 1, Isoform CRA_a; Alpha-1-Antitrypsin; Serine (Or Cysteine) Proteinase Inhibitor, Clade A, Member 1; AAT; Protease Inhibitor 1 (Anti-Elastase)
-
AA Sequence
EDAQETDTSQQDQSPTYRKISSNLADFAFSLYRELVHQSNTSNIFFSPMSITTAFAMLSLGSKGDTRKQILEGLEFNLTQIPEADIHKAFHHLLQTLNRPDSELQLNTGNGLFVNKNLKLVEKFLEEVKNNYHSEAFSVNFADSEEAKKVINDYVEKGTQGKIVDLMKQLDEDTVFALVNYIFFKGKWKRPFNPEHTRDADFHVDKSTTVKVPMMNRLGMFDMHYCSTLSSWVLMMDYLGNATAIFLLPDDGKMQHLEQTLTKDLISRFLLNRQTRSAILYFPKLSISGTYNLKTLLSSLGITRVFNNDADLSGITEDAPLKLSQAVHKAVLTLDERGTEAAGATVVEAVPMSLPPQVKFDHPFIFMIVESETQSPLFVGKVIDPTR
-
Molecular Weight
Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
