Siglec-3/CD33 Protein, Human (HEK293, hFc)

Customer Review

Based on 1 Customer Validation

Siglec-3/CD33 protein is a sialic acid-binding lectin that mediates cell-cell interactions and maintains immune cell quiescence. It prefers α-2,3- and α-2,6-linked glycans with sialic acid. Siglec-3/CD33 Protein, Human (HEK293, hFc) is the recombinant human-derived Siglec-3/CD33 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Siglec-3/CD33 protein is a sialic acid-binding lectin that mediates cell-cell interactions and maintains immune cell quiescence. It prefers α-2,3- and α-2,6-linked glycans with sialic acid. Siglec-3/CD33 Protein, Human (HEK293, hFc) is the recombinant human-derived Siglec-3/CD33 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The Siglec-3/CD33 protein, a sialic-acid-binding immunoglobulin-like lectin, plays a crucial role in mediating cell-cell interactions and maintaining immune cells in a resting state. It exhibits a preference for recognizing and binding alpha-2,3- and more avidly alpha-2,6-linked sialic acid-bearing glycans. Upon engagement with ligands like C1q or sialylated glycoproteins, two immunoreceptor tyrosine-based inhibitory motifs (ITIMs) within CD33's cytoplasmic tail undergo phosphorylation by Src-like kinases such as LCK. These phosphorylated ITIMs serve as docking sites for recruiting and activating protein-tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2, which, in turn, regulate downstream pathways through dephosphorylation of signaling molecules. CD33's repressive effect on monocyte activation involves phosphoinositide 3-kinase/PI3K. Structurally, the protein forms homodimers through disulfide linkages and interacts with PTPN6/SHP-1 and PTPN11/SHP-2 upon phosphorylation. It also engages with C1QA via its C-terminus, activating CD33 inhibitory motifs.

Verified Bioactivity

1.Immobilized Human Siglec-3 at 0.5 μg/mL(100 μl/well) on the plate. Dose response curve for Biotinylated Anti-Siglec-3 Antibody, hFc Tag with the EC50 of 21.8 ng/mL determined by ELISA.
2.Immobilized Human CD33 at 2 μg/mL (100 μL/well) can bind Anti-CD33 Antibody, the ED50 for this effect is 8.312 ng/mL.

MCE Validation Data

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized Human CD33 at 2 μg/mL (100 μL/well) can bind Anti-CD33 Antibody, The ED50 for this effect is 8.312 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD33 (D18-H259, R69G)
      Accession # P20138-1/AAH28152.1
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD33; Myeloid Cell Surface Antigen CD33; CD33 Molecule; FLJ00391; SIGLEC3; Gp67; CD33 Antigen (Gp67); CDNA FLJ50122, Highly Similar To Myeloid Cell Surface Antigen CD33; CD33rSiglec; Sialic Acid Binding Ig-Like Lectin 3; SIGLEC-3; CD33 Molecule Transcript

  • AA Sequence

    DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH

  • Molecular Weight

    Approximately 64-85 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PBS, 8% trehalose, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00