SMAD5 Protein, Human (GST)
SMAD5 Protein, Human (GST) is the recombinant human-derived SMAD5, expressed by E. coli , with GST labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SMAD5 Protein, Human (GST) is the recombinant human-derived SMAD5, expressed by E. coli , with GST labeled tag. ,
Background
Smad1/5/9 is a transcriptional regulator involved in various cellular processes such as embryonic development, cell differentiation, angiogenesis, and tissue homeostasis. Upon BMP ligand binding to cell surface receptors, it is phosphorylated by activated type I BMP receptors (BMPRIs) and associates with SMAD4 to form a heteromeric complex that translocates into the nucleus, functioning as a transcription factor. The hetero-trimeric complex recognizes cis-regulatory elements containing Smad Binding Elements (SBEs) to modulate signaling network outcomes. Non-phosphorylated SMAD5 plays a cytoplasmic role in energy metabolism regulation by promoting mitochondrial respiration and glycolysis in response to cytoplasmic pH changes. Mechanistically, it interacts with hexokinase 1 (HK1) to accelerate glycolysis.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag GST
-
Accession
Q99717 (M1-S465)
-
Gene ID4090
-
Protein Length
Full Length
-
Synonyms
SMAD5; SMAD, Mothers Against DPP Homolog 5; Prev. MADH5; Mothers Against DPP Homolog 5; JV5-1; Mothers Against DPP Homolog; Dwfc; SMAD Family Member; Mothers Against Decapentaplegic Homolog 5; MAD Homolog 5; MAD, Mothers Against Decapentaplegic Homolog 5
-
AA Sequence
MTSMASLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNNTPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS
-
Predicted Molecular Mass
82 kDa
-
Molecular Weight
Approximately 82 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
/
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
