SMR3B Protein, Human (HEK293, His)
Based on 1 Customer Validation
SMR3B Protein is an important oncogenic driver that promotes cancer progression and metastasis. SMR3B overexpression in multiple cancers has pleiotropic effects, causing cells to acquire hallmark traits such as sustained proliferative signaling, replicative immortality, genome instability and mutation, resistance to cell death, angiogenesis etc. In addition, up-regulation of SMR3B activates the Src kinase, which initiates a number of signal pathways culminating in the phosphorylation of ERK1/2, STAT3, and p130. SMR3B Protein, Human (HEK293, His) is the recombinant human-derived SMR3B protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
SMR3B Protein is an important oncogenic driver that promotes cancer progression and metastasis. SMR3B overexpression in multiple cancers has pleiotropic effects, causing cells to acquire hallmark traits such as sustained proliferative signaling, replicative immortality, genome instability and mutation, resistance to cell death, angiogenesis etc. In addition, up-regulation of SMR3B activates the Src kinase, which initiates a number of signal pathways culminating in the phosphorylation of ERK1/2, STAT3, and p130. SMR3B Protein, Human (HEK293, His) is the recombinant human-derived SMR3B protein, expressed by HEK293 , with C-His labeled tag.
Background
Submaxillary gland androgen-regulated protein 3B (SMR3B) is an important oncogenic driver that promotes cancer progression and metastasis. SMR3B overexpression in multiple cancers has pleiotropic effects, causing cells to acquire hallmark traits such as sustained proliferative signaling, replicative immortality, genome instability and mutation, resistance to cell death, angiogenesis etc. In addition, up-regulation of SMR3B activates the Src kinase, which initiates a number of signal pathways culminating in the phosphorylation of ERK1/2, STAT3, and p130. Importantly, its tumor specific expression in a broad range of cancers and absence in normal tissues make it an attractive target[1][2].
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P02814/NP_006676.1 (Q23-P79)
-
Gene ID10879 [NCBI]
-
Molecular Construction
-
N-term
-
SMR3B (M1-P79)
Accession # P02814 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
SMR3B; Proline Rich 3; Prev. PROL3; Submaxillary Gland Androgen Regulated Protein 3 Homolog B (Mouse); PRL3; Submaxillary Gland Androgen Regulated Protein 3 Homolog B; P-B; Salivary Proline-Rich Protein; Submaxillary Gland Androgen-Regulated Protein 3B; S
-
AA Sequence
QRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQP
-
Molecular Weight
Approximately 8 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Liang F, et al. PRL3 promotes cell invasion and proliferation by down-regulation of Csk leading to Src activation. J Biol Chem. 2007 Feb 23;282(8):5413-9. [Content Brief]
[2]. Chia PL, et al. PRL3 as a therapeutic target for novel cancer immunotherapy in multiple cancer types. Theranostics. 2023 Mar 21;13(6):1876-1891. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
