SMR3B Protein, Human (HEK293, His)

SMR3B Protein is an important oncogenic driver that promotes cancer progression and metastasis. SMR3B overexpression in multiple cancers has pleiotropic effects, causing cells to acquire hallmark traits such as sustained proliferative signaling, replicative immortality, genome instability and mutation, resistance to cell death, angiogenesis etc. In addition, up-regulation of SMR3B activates the Src kinase, which initiates a number of signal pathways culminating in the phosphorylation of ERK1/2, STAT3, and p130. SMR3B Protein, Human (HEK293, His) is the recombinant human-derived SMR3B protein, expressed by HEK293 , with C-His labeled tag.

Submaxillary gland androgen-regulated protein 3B (SMR3B) is an important oncogenic driver that promotes cancer progression and metastasis. SMR3B overexpression in multiple cancers has pleiotropic effects, causing cells to acquire hallmark traits such as sustained proliferative signaling, replicative immortality, genome instability and mutation, resistance to cell death, angiogenesis etc. In addition, up-regulation of SMR3B activates the Src kinase, which initiates a number of signal pathways culminating in the phosphorylation of ERK1/2, STAT3, and p130. Importantly, its tumor specific expression in a broad range of cancers and absence in normal tissues make it an attractive target^[1][2].

Human

HEK293

C-6*His

P02814/NP_006676.1 (Q23-P79)

10879  [NCBI]

Full Length of Mature Protein

QRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQP

Approximately 9 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Liang F, et al. PRL3 promotes cell invasion and proliferation by down-regulation of Csk leading to Src activation. J Biol Chem. 2007 Feb 23;282(8):5413-9.  [Content Brief]

  [2]. Chia PL, et al. PRL3 as a therapeutic target for novel cancer immunotherapy in multiple cancer types. Theranostics. 2023 Mar 21;13(6):1876-1891.  [Content Brief]