SNCA Protein, Human (A53T)

Measured by its binding ability in a functional ELISA. Immobilized Human Alpha-Synuclein (A53T), Tag Free at 1 μg/mL (100 μL/well) can bind Anti-Synucelin alpha/beta Monoclonal Antibody with the EC₅₀ of 4.80 ng/ml.

Human

E. coli

Tag Free

P37840-1 (M1-A140, A53T)

6622

Full Length

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Solution

Supplied as 0.22 μm filtered solution of 50 mM HEPES, 100 mM NaCl, pH7.5 with 10% trehalose as protectant.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.