ST2/IL1RL1 Protein, Cynomolgus (HEK293, His)
Based on 1 Customer Validation
ST2/IL1RL1 Protein is a member of the Toll-like receptor superfamily, and is a soluble and membrane-bound protein that is the receptor for interleukin 33. It recruits MYD88, IRAK1/4, and TRAF6 after stimulation, leading to MAPK phosphorylation. It is also an inhibitor of interleukin 1 receptor (IL-1RI) and Toll-like receptor 4 (TLR4) signaling, maintaining endotoxin tolerance. ST2/IL1RL1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived ST2/IL1RL1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
ST2/IL1RL1 Protein is a member of the Toll-like receptor superfamily, and is a soluble and membrane-bound protein that is the receptor for interleukin 33. It recruits MYD88, IRAK1/4, and TRAF6 after stimulation, leading to MAPK phosphorylation. It is also an inhibitor of interleukin 1 receptor (IL-1RI) and Toll-like receptor 4 (TLR4) signaling, maintaining endotoxin tolerance. ST2/IL1RL1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived ST2/IL1RL1 protein, expressed by HEK293 , with C-His labeled tag.
Background
ST2/IL1RL1 Protein is a member of the toll-like receptor superfamily, but unlike other members, it does not induce inflammatory responses by activating NF-κB, although it can activate MAP kinase. ST2/IL1RL1 Protein exists in two forms (soluble and membrane-bound forms). When the heart muscle is stretched, the ST2 gene is upregulated, and the circulating soluble ST2/IL1RL1 Protein concentration rapidly increases. Its membrane-bound form serves as a receptor for IL-33, which binds to IL-33 to regulate cardiac diseases and injuries, such as ischemic events, triggering a cardioprotective effect and maintaining cardiac function. The membrane-bound form of ST2/IL1RL1 Protein negatively regulates the signaling transduction of type I interleukin 1 receptor (IL-1RI) and toll-like receptor 4 (TLR4) by sequestering the adaptor MyD88 and Mal. It can maintain endotoxin tolerance[1][2].
Overexpression of ST2/IL1RL1 Protein increases the production of neutrophil chemokine IL-8 and enhances HRV1B-induced IP-10 (a chemokine involved in exacerbation of asthma). ST2/IL1RL1 Protein also promotes proinflammatory responses to airway bacterial and viral infections. Therefore, ST2/IL1RL1 Protein plays an important role in inflammation regulation[3].
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-His
-
Accession
XP_005575214.1 (A18-C331)
-
Molecular Construction
-
N-term
-
ST2 (A18-C331)
Accession # XP_005575214.1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
IL1RL1; ST2V; Interleukin 1 Receptor Like 1; Homolog Of Mouse Growth Stimulation-Expressed; DER4; Suppressor Of Tumorigenicity 2; ST2; Interleukin 1 Receptor-Like 1 Isoform 2; T1; Interleukin 1 Receptor-Like 1 Isoform 1; Interleukin-1 Receptor-Like 1; Int
-
AA Sequence
AKFSKQSWGLENEALIVRCPRQGKSSYIVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAEVADSGIYTCIVRSPTFNRTGYANVTIYKKQPDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYKAHKSFLVIDNVMTDDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSRFPVIRAPAHNETKEVEIGENTNLTCSACFGKGAQFLAAVQWQLNGNKITDFSEPRIQQEEGQNQSFSDGLACVNTVLRIADVKEEDLLLRYDCLALNLHGLRRHTIRLSRKNPIDHQSTYC
-
Predicted Molecular Mass
37.1 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)