1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. ST2/IL1RL1 Protein, Cynomolgus (HEK293, His)

ST2/IL1RL1 Protein is a member of the Toll-like receptor superfamily, and is a soluble and membrane-bound protein that is the receptor for interleukin 33. It recruits MYD88, IRAK1/4, and TRAF6 after stimulation, leading to MAPK phosphorylation. It is also an inhibitor of interleukin 1 receptor (IL-1RI) and Toll-like receptor 4 (TLR4) signaling, maintaining endotoxin tolerance. ST2/IL1RL1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived ST2/IL1RL1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ST2/IL1RL1 Protein is a member of the Toll-like receptor superfamily, and is a soluble and membrane-bound protein that is the receptor for interleukin 33. It recruits MYD88, IRAK1/4, and TRAF6 after stimulation, leading to MAPK phosphorylation. It is also an inhibitor of interleukin 1 receptor (IL-1RI) and Toll-like receptor 4 (TLR4) signaling, maintaining endotoxin tolerance. ST2/IL1RL1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived ST2/IL1RL1 protein, expressed by HEK293 , with C-His labeled tag.

Background

ST2/IL1RL1 Protein is a member of the toll-like receptor superfamily, but unlike other members, it does not induce inflammatory responses by activating NF-κB, although it can activate MAP kinase. ST2/IL1RL1 Protein exists in two forms (soluble and membrane-bound forms). When the heart muscle is stretched, the ST2 gene is upregulated, and the circulating soluble ST2/IL1RL1 Protein concentration rapidly increases. Its membrane-bound form serves as a receptor for IL-33, which binds to IL-33 to regulate cardiac diseases and injuries, such as ischemic events, triggering a cardioprotective effect and maintaining cardiac function. The membrane-bound form of ST2/IL1RL1 Protein negatively regulates the signaling transduction of type I interleukin 1 receptor (IL-1RI) and toll-like receptor 4 (TLR4) by sequestering the adaptor MyD88 and Mal. It can maintain endotoxin tolerance[1][2].
Overexpression of ST2/IL1RL1 Protein increases the production of neutrophil chemokine IL-8 and enhances HRV1B-induced IP-10 (a chemokine involved in exacerbation of asthma). ST2/IL1RL1 Protein also promotes proinflammatory responses to airway bacterial and viral infections. Therefore, ST2/IL1RL1 Protein plays an important role in inflammation regulation[3].

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Cynomolgus

Source

HEK293

Tag

C-His

Accession

XP_005575214.1 (A18-C331)

Gene ID
Molecular Construction
N-term
ST2 (A18-C331)
Accession # XP_005575214.1
His
C-term
Protein Length

Partial

Synonyms
Interleukin-1 receptor-like 1; Interleukin-33 receptor alpha chain; Il1rl1; Ly84; St2; Ste2
AA Sequence

AKFSKQSWGLENEALIVRCPRQGKSSYIVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAEVADSGIYTCIVRSPTFNRTGYANVTIYKKQPDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYKAHKSFLVIDNVMTDDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSRFPVIRAPAHNETKEVEIGENTNLTCSACFGKGAQFLAAVQWQLNGNKITDFSEPRIQQEEGQNQSFSDGLACVNTVLRIADVKEEDLLLRYDCLALNLHGLRRHTIRLSRKNPIDHQSTYC

Molecular Weight

Approximately 37.1 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ST2/IL1RL1 Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ST2/IL1RL1 Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ST2/IL1RL1 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P76660
Quantity:
MCE Japan Authorized Agent: