ST2/IL1RL1 Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

ST2/IL1RL1 Protein is a member of the Toll-like receptor superfamily, and is a soluble and membrane-bound protein that is the receptor for interleukin 33. It recruits MYD88, IRAK1/4, and TRAF6 after stimulation, leading to MAPK phosphorylation. It is also an inhibitor of interleukin 1 receptor (IL-1RI) and Toll-like receptor 4 (TLR4) signaling, maintaining endotoxin tolerance. ST2/IL1RL1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived ST2/IL1RL1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

ST2/IL1RL1 Protein is a member of the Toll-like receptor superfamily, and is a soluble and membrane-bound protein that is the receptor for interleukin 33. It recruits MYD88, IRAK1/4, and TRAF6 after stimulation, leading to MAPK phosphorylation. It is also an inhibitor of interleukin 1 receptor (IL-1RI) and Toll-like receptor 4 (TLR4) signaling, maintaining endotoxin tolerance. ST2/IL1RL1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived ST2/IL1RL1 protein, expressed by HEK293 , with C-His labeled tag.

Background

ST2/IL1RL1 Protein is a member of the toll-like receptor superfamily, but unlike other members, it does not induce inflammatory responses by activating NF-κB, although it can activate MAP kinase. ST2/IL1RL1 Protein exists in two forms (soluble and membrane-bound forms). When the heart muscle is stretched, the ST2 gene is upregulated, and the circulating soluble ST2/IL1RL1 Protein concentration rapidly increases. Its membrane-bound form serves as a receptor for IL-33, which binds to IL-33 to regulate cardiac diseases and injuries, such as ischemic events, triggering a cardioprotective effect and maintaining cardiac function. The membrane-bound form of ST2/IL1RL1 Protein negatively regulates the signaling transduction of type I interleukin 1 receptor (IL-1RI) and toll-like receptor 4 (TLR4) by sequestering the adaptor MyD88 and Mal. It can maintain endotoxin tolerance[1][2].
Overexpression of ST2/IL1RL1 Protein increases the production of neutrophil chemokine IL-8 and enhances HRV1B-induced IP-10 (a chemokine involved in exacerbation of asthma). ST2/IL1RL1 Protein also promotes proinflammatory responses to airway bacterial and viral infections. Therefore, ST2/IL1RL1 Protein plays an important role in inflammation regulation[3].

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • ST2 (A18-C331)
      Accession # XP_005575214.1
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    IL1RL1; ST2V; Interleukin 1 Receptor Like 1; Homolog Of Mouse Growth Stimulation-Expressed; DER4; Suppressor Of Tumorigenicity 2; ST2; Interleukin 1 Receptor-Like 1 Isoform 2; T1; Interleukin 1 Receptor-Like 1 Isoform 1; Interleukin-1 Receptor-Like 1; Int

  • AA Sequence

    AKFSKQSWGLENEALIVRCPRQGKSSYIVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAEVADSGIYTCIVRSPTFNRTGYANVTIYKKQPDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYKAHKSFLVIDNVMTDDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSRFPVIRAPAHNETKEVEIGENTNLTCSACFGKGAQFLAAVQWQLNGNKITDFSEPRIQQEEGQNQSFSDGLACVNTVLRIADVKEEDLLLRYDCLALNLHGLRRHTIRLSRKNPIDHQSTYC

  • Predicted Molecular Mass

    37.1 kDa

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00