1. Recombinant Proteins
  2. Others
  3. Syndecan-4 Protein, Human (HEK293, His)

Studies have proven that Syndecan-4 protein is a cell surface proteoglycan that cooperates with SDCBP and PDCD6IP to play a key role in regulating exosome biogenesis. Syndecan-4 functions as a homodimer and interacts with various intracellular partners through its cytoplasmic domain. Syndecan-4 Protein, Human (HEK293, His) is the recombinant human-derived Syndecan-4 protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

Studies have proven that Syndecan-4 protein is a cell surface proteoglycan that cooperates with SDCBP and PDCD6IP to play a key role in regulating exosome biogenesis. Syndecan-4 functions as a homodimer and interacts with various intracellular partners through its cytoplasmic domain. Syndecan-4 Protein, Human (HEK293, His) is the recombinant human-derived Syndecan-4 protein, expressed by HEK293 , with C-His labeled tag.

Background

Syndecan-4, a cell surface proteoglycan, emerges as a pivotal regulator of exosome biogenesis, working in collaboration with SDCBP and PDCD6IP. It forms homodimers and engages in interactions with various proteins, including GIPC through its cytoplasmic domain and NUDT16L1. Syndecan-4 further interacts with CDCP1 and SDCBP, emphasizing its involvement in diverse cellular processes and signaling pathways. The complex interplay between Syndecan-4 and these interacting partners underscores its multifunctional role at the cell surface, suggesting potential contributions to exosome dynamics and other cellular activities.

Species

Human

Source

HEK293

Tag

C-His

Accession

P31431-1 (E19-E145)

Gene ID
Molecular Construction
N-term
Syndecan-4 (E19-E145)
Accession # P31431-1
His
C-term
Protein Length

Extracellular Domain

Synonyms
Ryudocan core protein; SDC 4; SYND 4; SYND4; syndecan 4
AA Sequence

ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE

분자량

Approximately 15.3 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

Syndecan-4 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Syndecan-4 Protein, Human (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Syndecan-4 Protein, Human (HEK293, His)
Cat. No.:
HY-P73623
수량:
MCE Japan Authorized Agent: