Syndecan-4 Protein, Human (HEK293, His)
Based on 1 Customer Validation
Studies have proven that Syndecan-4 protein is a cell surface proteoglycan that cooperates with SDCBP and PDCD6IP to play a key role in regulating exosome biogenesis. Syndecan-4 functions as a homodimer and interacts with various intracellular partners through its cytoplasmic domain. Syndecan-4 Protein, Human (HEK293, His) is the recombinant human-derived Syndecan-4 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Studies have proven that Syndecan-4 protein is a cell surface proteoglycan that cooperates with SDCBP and PDCD6IP to play a key role in regulating exosome biogenesis. Syndecan-4 functions as a homodimer and interacts with various intracellular partners through its cytoplasmic domain. Syndecan-4 Protein, Human (HEK293, His) is the recombinant human-derived Syndecan-4 protein, expressed by HEK293 , with C-His labeled tag.
Background
Syndecan-4, a cell surface proteoglycan, emerges as a pivotal regulator of exosome biogenesis, working in collaboration with SDCBP and PDCD6IP. It forms homodimers and engages in interactions with various proteins, including GIPC through its cytoplasmic domain and NUDT16L1. Syndecan-4 further interacts with CDCP1 and SDCBP, emphasizing its involvement in diverse cellular processes and signaling pathways. The complex interplay between Syndecan-4 and these interacting partners underscores its multifunctional role at the cell surface, suggesting potential contributions to exosome dynamics and other cellular activities.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P31431-1 (E19-E145)
-
Molecular Construction
-
N-term
-
Syndecan-4 (E19-E145)
Accession # P31431-1 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
SDC4; Ryudocan Core Protein; Syndecan 4; Syndecan-4; Amphiglycan; Ryudocan; SYND4; Ryudocan Amphiglycan; Syndecan 4 (Amphiglycan, Ryudocan); Syndecan; Syndecan Proteoglycan 4
-
AA Sequence
ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE
-
Predicted Molecular Mass
15.3 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
