1. Recombinant Proteins
  2. Others
  3. Syndecan-4 Protein, Human (HEK293, His)

Studies have proven that Syndecan-4 protein is a cell surface proteoglycan that cooperates with SDCBP and PDCD6IP to play a key role in regulating exosome biogenesis. Syndecan-4 functions as a homodimer and interacts with various intracellular partners through its cytoplasmic domain. Syndecan-4 Protein, Human (HEK293, His) is the recombinant human-derived Syndecan-4 protein, expressed by HEK293 , with C-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
50 μg En stock
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

Studies have proven that Syndecan-4 protein is a cell surface proteoglycan that cooperates with SDCBP and PDCD6IP to play a key role in regulating exosome biogenesis. Syndecan-4 functions as a homodimer and interacts with various intracellular partners through its cytoplasmic domain. Syndecan-4 Protein, Human (HEK293, His) is the recombinant human-derived Syndecan-4 protein, expressed by HEK293 , with C-His labeled tag.

Background

Syndecan-4, a cell surface proteoglycan, emerges as a pivotal regulator of exosome biogenesis, working in collaboration with SDCBP and PDCD6IP. It forms homodimers and engages in interactions with various proteins, including GIPC through its cytoplasmic domain and NUDT16L1. Syndecan-4 further interacts with CDCP1 and SDCBP, emphasizing its involvement in diverse cellular processes and signaling pathways. The complex interplay between Syndecan-4 and these interacting partners underscores its multifunctional role at the cell surface, suggesting potential contributions to exosome dynamics and other cellular activities.

Species

Human

Source

HEK293

Tag

C-His

Accession

P31431-1 (E19-E145)

Gene ID
Molecular Construction
N-term
Syndecan-4 (E19-E145)
Accession # P31431-1
His
C-term
Protein Length

Extracellular Domain

Synonyms
Ryudocan core protein; SDC 4; SYND 4; SYND4; syndecan 4
AA Sequence

ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE

Peso molecular

Approximately 15.3 kDa

Glycosylation
Yes
Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación

Syndecan-4 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

Syndecan-4 Protein, Human (HEK293, His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
Syndecan-4 Protein, Human (HEK293, His)
Cat. No.:
HY-P73623
Cantidad:
MCE Japan Authorized Agent: