TAFA5/FAM19A5 Protein, Mouse (His)

As a chemokine-like molecule, TAFA5/FAM19A5 protein activates GPCRs such as S1PR2 and FPR2 to regulate cell proliferation and migration. It induces macrophage chemotactic migration through MAPK3/ERK1 and AKT1 pathways and inhibits TNFSF11/RANKL-induced osteoclast formation. TAFA5/FAM19A5 Protein, Mouse (His) is the recombinant mouse-derived TAFA5/FAM19A5 protein, expressed by E. coli , with N-His labeled tag.

TAFA5/FAM19A5, functioning as a chemokine-like protein, orchestrates cell proliferation and migration by activating G protein-coupled receptors (GPCRs), notably S1PR2 and FPR2. It stimulates the chemotactic migration of macrophages through the MAPK3/ERK1 and AKT1 pathway while concurrently inhibiting TNFSF11/RANKL-induced osteoclast formation by impeding the up-regulation of osteoclast fusogenic and differentiation genes, a process mediated by the GPCR FPR2. Acting as an adipokine, TAFA5/FAM19A5 negatively regulates vascular smooth muscle cell (VSMC) proliferation and migration in response to platelet-derived growth factor stimulation via GPCR S1PR2 and G protein GNA12/GNA13-transmitted RHOA signaling. This multifaceted role extends to inhibiting injury-induced cell proliferation and neointima formation in the femoral arteries, underscoring its regulatory impact on diverse cellular processes.

Mouse

E. coli

N-8*His

Q91WE9-1 (T44-S132)

/

Full Length of Isoform-1 Mature Protein

TCEIVTLDRDSSQPRRTIARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCTQPGGRIKTTTVS

13-14 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 300 mM NaCl, 10% Glycerol, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.