Fetal-tau/0N3R Protein, Human (His, solution)

Tau/0N3R protein is encoded by the Tau/0N3R gene and undergoes regulated alternative splicing to produce different mRNA species. Its expression varies in the nervous system according to the maturation and type of neurons. Tau/0N3R Protein, Human (His, solution) is the recombinant human-derived Tau/0N3R protein, expressed by E. coli , with N-His labeled tag.

The Tau/0N3R gene encodes the microtubule-associated protein tau (MAPT), which undergoes intricate, regulated alternative splicing, generating various mRNA species. The expression of MAPT transcripts varies across the nervous system, contingent on the stage of neuronal maturation and the specific neuron type. Mutations in the MAPT gene have been implicated in several neurodegenerative disorders, including Alzheimer's disease, Pick's disease, frontotemporal dementia, cortico-basal degeneration, and progressive supranuclear palsy. With biased expression observed in the brain (RPKM 70.2), kidney (RPKM 12.0), and two other tissues, Tau/0N3R plays a pivotal role in neurophysiology and is associated with diverse neuropathological conditions.

Human

E. coli

N-His

P10636-2/NP_058525.1 (A2-L352)

4137  [NCBI]

Full Length of Isoform-2 Mature Protein

AEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL

40-50 kDa

• 
  ≥ 85%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.