Thioredoxin/TXN Protein, E.coli (His)
Based on 1 Customer Validation
Thioredoxin/TXN Protein, E.coli (His) is a hydrogen carrier protein and exists widely in organism. Thioredoxin suppression disbalances insulin responsiveness in chicken cardiomyocytes through PI3K/Akt pathway inhibition.
- Species: E.coli
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Thioredoxin/TXN Protein, E.coli (His) is a hydrogen carrier protein and exists widely in organism. Thioredoxin suppression disbalances insulin responsiveness in chicken cardiomyocytes through PI3K/Akt pathway inhibition[1][2].
Thioredoxin (Txn) is a hydrogen carrier protein and exists widely in organism. Txn deficiency implicates cardiomyocytes injury has been proven. Thioredoxin (Txn) system is the most crucial antioxidant defense mechanism in cell consisting of Txn, thioredoxin reductase (TR) and Nicotinamide Adenine Dinucleotide Phosphate (NADPH). Txn system can redox regulate the insulin dependent glucose metabolism in heart and is essential for cell vitality[1][2].
Its ability to catalyze the reduction of insuline by precipitation reaction measured by absorbance at 650 nm. The specific activity is 3 units/mg, as measured under the described conditions.
Technical Parameters
-
Species E.coli
-
Source E. coli
-
Tag C-His
-
Accession
M26133 (M1-A109)
-
Gene ID948289 [NCBI]
-
Protein Length
Full Length
-
Synonyms
TXN; TRDX; TRX; TRX1; Thioredoxin; Trx; ATL-derived factor; ADF; Surface-associated sulphydryl protein; SASP; TXN Delta 3; Thioredoxin-2; Allergen Hom S Trx; Thioredoxin Delta 3; Thioredoxin, Mitochondrial; Testicular Tissue Protein Li 199; ADF; Surface-A
-
AA Sequence
MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
-
Predicted Molecular Mass
12 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 0.15 M NaCl, 1 mM EDTA, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Yang J, et, al. Dysfunction of thioredoxin triggers inflammation through activation of autophagy in chicken cardiomyocytes. Biofactors. 2020 Jul;46(4):579-590. [Content Brief]
[2]. Yang J, et, al. Selenium deficiency-induced thioredoxin suppression and thioredoxin knock down disbalanced insulin responsiveness in chicken cardiomyocytes through PI3K/Akt pathway inhibition. Cell Signal. 2017 Oct;38:192-200. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
