1. Recombinant Proteins
  2. Thioredoxin/TXN Protein, E.coli (His)

Thioredoxin/TXN Protein, E.coli (His)

Cat. No.: HY-P7802
Handling Instructions

Thioredoxin/TXN Protein, E.coli (His) is a hydrogen carrier protein and exists widely in organism. Thioredoxin suppression disbalances insulin responsiveness in chicken cardiomyocytes through PI3K/Akt pathway inhibition[1][2].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
250 μg $200 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rEcoThioredoxin/TXN, His; Trx; ADF; TRX1
Species

Others

Source

E. coli

Accession

AYG21414.1(M1-A109)

Gene ID

948289

Molecular Weight

Approximately 13 kDa

AA Sequence

MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Biological Activity
Its ability to catalyze the reduction of insuline by precipitation reaction measured by absorbance at 650 nm. The specific activity is 3 units/mg, as measured under the described conditions.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filter solution of 50 Mm Tris, 1 mM EDTA, trace Imidazole, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C. It is stable at -20℃ for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Background

Thioredoxin (Txn) is a hydrogen carrier protein and exists widely in organism. Txn deficiency implicates cardiomyocytes injury has been proven. Thioredoxin (Txn) system is the most crucial antioxidant defense mechanism in cell consisting of Txn, thioredoxin reductase (TR) and Nicotinamide Adenine Dinucleotide Phosphate (NADPH). Txn system can redox regulate the insulin dependent glucose metabolism in heart and is essential for cell vitality[1][2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Thioredoxin/TXN Protein, E.coli (His)
Cat. No.:
HY-P7802
Quantity:
MCE Japan Authorized Agent: