TIGIT Protein, Mouse (HEK293, mFc)

Customer Review

Based on 1 Customer Validation

TIGIT protein, with signaling receptor binding activity, functions upstream of T cell activation suppression. Active on the cell surface, it shares orthology with human TIGIT. Associated with modulating T cell responses, TIGIT exhibits biased expression, notably in the large intestine, small intestine, and other tissues. This highlights its potential in immune regulation within these contexts. TIGIT Protein, Mouse (HEK293, mFc) is the recombinant mouse-derived TIGIT protein, expressed by HEK293 , with C-mFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TIGIT protein, with signaling receptor binding activity, functions upstream of T cell activation suppression. Active on the cell surface, it shares orthology with human TIGIT. Associated with modulating T cell responses, TIGIT exhibits biased expression, notably in the large intestine, small intestine, and other tissues. This highlights its potential in immune regulation within these contexts. TIGIT Protein, Mouse (HEK293, mFc) is the recombinant mouse-derived TIGIT protein, expressed by HEK293 , with C-mFc labeled tag.

Background

TIGIT protein, characterized by its signaling receptor binding activity, operates upstream of negative regulation of T cell activation. Predicted to be active on the cell surface, this protein, orthologous to human TIGIT (T cell immunoreceptor with Ig and ITIM domains), is associated with the modulation of T cell responses. The expression of TIGIT is biased, with notable levels observed in the large intestine, small intestine, and several other tissues, emphasizing its potential role in immune regulation within these contexts.

Verified Bioactivity

Immobilized Recombinant Mouse CD155/PVR at 2.5 μg/mL (100 μL/well) can bind Biotinylated Recombinant Mouse TIGIT Protein. The ED50 for this effect is 88.36 ng/mL.

MCE Validation Data

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized Recombinant Mouse CD155/PVR at 2.5 μg/mL (100 μL/well) can bind Biotinylated Recombinant Mouse TIGIT Protein. The ED50 for this effect is 88.36 ng/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-mFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • TIGIT (A17-G141)
      Accession # NP_001139797
    • mFc
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    TIGIT; DKFZp667A205; Prev. VSIG9; FLJ39873; Prev. VSTM3; V-Set And Immunoglobulin Domain Containing 9; V-Set And Transmembrane Domain-Containing Protein 3; Washington University Cell Adhesion Molecule; T-Cell Immunoreceptor With Ig And ITIM Domains; V-Set

  • AA Sequence

    AFLATGATAGTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFQTAPLG

  • Predicted Molecular Mass

    39.9 kDa

  • Molecular Weight

    Approximately 42-52 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00