TL1A/TNFSF15 Protein, Human (168a.a, HEK293, Fc)
Based on 1 Customer Validation
TL1A/TNFSF15 Protein, the receptor for TNFRSF25 and TNFRSF6B, activates NF-kappa-B and promotes caspase activation, leading to apoptosis. It also inhibits vascular endothelial growth and angiogenesis in vitro. Operating as a homotrimer, it plays a crucial role in diverse cellular processes, including immune response and apoptosis regulation. TL1A/TNFSF15 Protein, Human (168a.a, HEK293, Fc) is the recombinant human-derived TL1A/TNFSF15 protein, expressed by HEK293, with N-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TL1A/TNFSF15 Protein, the receptor for TNFRSF25 and TNFRSF6B, activates NF-kappa-B and promotes caspase activation, leading to apoptosis. It also inhibits vascular endothelial growth and angiogenesis in vitro. Operating as a homotrimer, it plays a crucial role in diverse cellular processes, including immune response and apoptosis regulation. TL1A/TNFSF15 Protein, Human (168a.a, HEK293, Fc) is the recombinant human-derived TL1A/TNFSF15 protein, expressed by HEK293, with N-hFc labeled tag.
Background
TL1A/TNFSF15 Protein acts as the receptor for TNFRSF25 and TNFRSF6B, facilitating the activation of NF-kappa-B and promoting the activation of caspases, leading to apoptosis. Additionally, it exhibits inhibitory effects on vascular endothelial growth and angiogenesis in vitro. The protein functions as a homotrimer, underscoring its role in diverse cellular processes, including immune response and apoptosis regulation.
Verified Bioactivity
Immobilized Human DR3 Protein, His Tag at 5 μg/mL (100 μL/well) can bind Human TL1A Protein, Fc Tag with a linear range of 0.5-20 ng/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-hFc
-
Accession
O95150-1 (V84-L251)
-
Gene ID9966
-
Molecular Construction
-
N-term
-
hFc
-
TL1A (V84-L251)
Accession # O95150-1 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
TNFSF15; TL1A; TNF Superfamily Member 15; Vascular Endothelial Growth Inhibitor-192A; Vascular Endothelial Cell Growth Inhibitor; Vascular Endothelial Growth Inhibitor; TNF Ligand-Related Molecule 1; TNF Superfamily Ligand TL1A; VEGI; MGC129934; TL1; MGC1
-
AA Sequence
VYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
-
Predicted Molecular Mass
85.1 kDa
-
Molecular Weight
Approximately 95-110 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from 0.22 μm filtered solution of PBS, pH 7.4 with 10% trehalose as protectant.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
