1. Recombinant Proteins
  2. Others
  3. TMIGD2 Protein, Human (HEK293, Fc)

TMIGD2 is a multifaceted protein actively involved in cellular processes, including cell-cell interactions, migration, and angiogenesis. Its interaction with HHLA2 enhances T cell proliferation and cytokine production through AKT-dependent signaling during TCR-mediated activation. TMIGD2 Protein, Human (HEK293, Fc) is the recombinant human-derived TMIGD2 protein, expressed by HEK293 , with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

TMIGD2 is a multifaceted protein actively involved in cellular processes, including cell-cell interactions, migration, and angiogenesis. Its interaction with HHLA2 enhances T cell proliferation and cytokine production through AKT-dependent signaling during TCR-mediated activation. TMIGD2 Protein, Human (HEK293, Fc) is the recombinant human-derived TMIGD2 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

TMIGD2, a multifaceted protein, actively participates in various cellular processes such as cell-cell interaction, cell migration, and angiogenesis. Its interaction with HHLA2 highlights its role in costimulating T-cells during TCR-mediated activation, thereby enhancing T-cell proliferation and cytokine production through an AKT-dependent signaling cascade. TMIGD2 may also engage in homophilic interactions, potentially regulating cell-cell communication. Additionally, it forms interactions with CACNB2, DST, MIA, and NCKIPSD, indicating its involvement in diverse cellular pathways and signaling networks. These interactions collectively underscore the versatile functions of TMIGD2 in orchestrating essential cellular activities.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q96BF3-1/NP_653216.2 (L23-G150)

Gene ID
Molecular Construction
N-term
TMIGD2 (L23-G150)
Accession # Q96BF3-1/NP_653216.2
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
Transmembrane and immunoglobulin domain-containing protein 2; Immunoglobulin and proline-rich receptor 1; IGPR1; TMIGD2
AA Sequence

LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPG

Predicted Molecular Mass
40.9 kDa
Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

TMIGD2 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

TMIGD2 Protein, Human (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
TMIGD2 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P77249
수량:
MCE Japan Authorized Agent: