Copy Link Print Information

TMX1 Protein, Human (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

TMX1 Protein is a member of the protein disulfide isomerase (PDI) family and is a transmembrane thiol isomerase. TMX1 Protein can participate in various redox reactions, reversibly oxidizes to disulfide through its active center thiol, and catalyzes the thiol-disulfide exchange reaction. In addition, TMX1 Protein negatively regulates the activation of αibβ3 integrin and platelet aggregation outside the cell. TMX1 Protein, Human (HEK293, Fc) is the recombinant human-derived TMX1 protein, expressed by HEK293 , with C-mFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • TMX1 Protein, Human (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TMX1 Protein is a member of the protein disulfide isomerase (PDI) family and is a transmembrane thiol isomerase. TMX1 Protein can participate in various redox reactions, reversibly oxidizes to disulfide through its active center thiol, and catalyzes the thiol-disulfide exchange reaction. In addition, TMX1 Protein negatively regulates the activation of αibβ3 integrin and platelet aggregation outside the cell. TMX1 Protein, Human (HEK293, Fc) is the recombinant human-derived TMX1 protein, expressed by HEK293 , with C-mFc labeled tag.

Background

TMX1 Protein can participate in various oxidation-reduction reactions, both oxidizing and reducing disulfide bonds, and selectively acting on membrane-associated polypeptides[1].
As a thiol tumor suppressor, TMX1 Protein can increase mitochondrial ATP production and apoptosis progression. Under oxidative conditions, TMX1 Protein interacts with SERCA2b in a thiol-dependent manner, thereby reducing SERCA activity and reducing endoplasmic reticulum Ca2+ load[2].
The extracellular TMX1 protein has a negative regulatory effect on the activation of αibβ3 integrin and platelet aggregation[3].

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-mouse IgG1 Fc
  • Accession

    AAH36460 (R27-S180)

  • Gene ID
    81542  [NCBI]
  • Molecular Construction
    • N-term
    • TMX1 (R27-S180)
      Accession # AAH36460
    • mFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    TMX1; Thioredoxin Domain-Containing Protein 1; Prev. TXNDC1; Protein Disulfide-Isomerase TMX1; Prev. TXNDC; Thioredoxin Domain Containing 1; TMX; Thioredoxin-Related Transmembrane Protein; Thioredoxin-Related Transmembrane Protein 1; Thioredoxin Domain-Containing; PDIA11; Thioredoxin Domain Containing; Protein Disulfide Isomerase Family A, Member 11; Thioredoxin Related Transmembrane Protein 1; Transmembrane Trx-Related Protein

  • AA Sequence

    RRSNVRVITDENWRELLEGDWMIEFYAPWCPACQNLQPEWESFAEWGEDLEVNIAKVDVTEQPGLSGRFIINALPTIYHCKDGEFRRYQGPRTKKDFINFISDKEWKSIEPVSSWFGPGSVLMSSMSALFQLSMWIRTCHNYFIEDLGLPVWGS

  • Predicted Molecular Mass

    43.7 kDa

  • Molecular Weight

    Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • TMX1 Protein, Human (HEK293, Fc) Product Image
    1/16
  • TMX1 Protein, Human (HEK293, Fc) Product Image