TMX1 Protein, Human (HEK293, Fc)

TMX1 Protein is a member of the protein disulfide isomerase (PDI) family and is a transmembrane thiol isomerase. TMX1 Protein can participate in various redox reactions, reversibly oxidizes to disulfide through its active center thiol, and catalyzes the thiol-disulfide exchange reaction. In addition, TMX1 Protein negatively regulates the activation of αibβ3 integrin and platelet aggregation outside the cell. TMX1 Protein, Human (HEK293, Fc) is the recombinant human-derived TMX1 protein, expressed by HEK293 , with C-mFc labeled tag.

TMX1 Protein can participate in various oxidation-reduction reactions, both oxidizing and reducing disulfide bonds, and selectively acting on membrane-associated polypeptides^[1].
As a thiol tumor suppressor, TMX1 Protein can increase mitochondrial ATP production and apoptosis progression. Under oxidative conditions, TMX1 Protein interacts with SERCA2b in a thiol-dependent manner, thereby reducing SERCA activity and reducing endoplasmic reticulum Ca2+ load^[2].
The extracellular TMX1 protein has a negative regulatory effect on the activation of αibβ3 integrin and platelet aggregation^[3].

Human

HEK293

C-mFc

AAH36460 (R27-S180)

81542  [NCBI]

Partial

RRSNVRVITDENWRELLEGDWMIEFYAPWCPACQNLQPEWESFAEWGEDLEVNIAKVDVTEQPGLSGRFIINALPTIYHCKDGEFRRYQGPRTKKDFINFISDKEWKSIEPVSSWFGPGSVLMSSMSALFQLSMWIRTCHNYFIEDLGLPVWGS

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.