1. Recombinant Proteins
  2. TNF-alpha/TNFSF2 Protein, Mouse (His)

TNF-alpha/TNFSF2 Protein, Mouse (His)

Cat. No.: HY-P7417
Handling Instructions

TNF-alpha/TNFSF2 Protein, Mouse (His) is recombinant mouse tumor necrosis factor alpha (TNF-α) with his tag. TNF-alpha/TNFSF2 Protein, a major mediator of inflammation, is involved in a number of infectious and parasitic diseases.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $160 In-stock
Estimated Time of Arrival: December 31
50 μg $380 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rMuTNF-α, His; Cachectin; TNFSF2
Species

Mouse

Source

E. coli

Accession

P06804 (L80-L235)

Gene ID

21926

Molecular Weight

Approximately 18.3 kDa

AA Sequence

MHHHHHHMLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Biological Activity
The ED50 is <0.05 ng/mL as measured by L-929 mouse fibrosarcoma cells, corresponding to a specific activity of >2 × 107 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<1.0 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Tumor necrosis factor-α (TNF-α) is a pleiotropic cytokine produced by a wide variety of cell types of mostly hematopoietic, but also of nonhematopoietic, origin. TNFα is instrumental in the immune elimination of various infectious agents such as Candida albicans, Listeria monocytogenes, or mycobacteria and exerts potent proinflammatory effects, e.g. by inducing the expression of adhesion molecules such as VCAM-1, intercellular adhesion molecule 1 (ICAM-1), or E-selectin on endothelial cells and other cell types[1][2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNF-alpha/TNFSF2 Protein, Mouse (His)
Cat. No.:
HY-P7417
Quantity:
MCE Japan Authorized Agent: