1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily Neurotrophic Factors
  4. TNF Superfamily Ligands
  5. TNF-alpha
  6. TNF-alpha/TNFSF2 Protein, Mouse (His)

TNF-alpha/TNFSF2 Protein, Mouse (His)

Cat. No.: HY-P7417
COA Handling Instructions

TNF-alpha/TNFSF2 Protein, Mouse (His) is recombinant mouse tumor necrosis factor alpha (TNF-α) with his tag. TNF-alpha/TNFSF2 Protein, a major mediator of inflammation, is involved in a number of infectious and parasitic diseases.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $160 In-stock
Estimated Time of Arrival: December 31
50 μg $380 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

TNF-alpha/TNFSF2 Protein, Mouse (His) is recombinant mouse tumor necrosis factor alpha (TNF-α) with his tag. TNF-alpha/TNFSF2 Protein, a major mediator of inflammation, is involved in a number of infectious and parasitic diseases.

Background

Tumor necrosis factor-α (TNF-α) is a pleiotropic cytokine produced by a wide variety of cell types of mostly hematopoietic, but also of nonhematopoietic, origin. TNFα is instrumental in the immune elimination of various infectious agents such as Candida albicans, Listeria monocytogenes, or mycobacteria and exerts potent proinflammatory effects, e.g. by inducing the expression of adhesion molecules such as VCAM-1, intercellular adhesion molecule 1 (ICAM-1), or E-selectin on endothelial cells and other cell types[1][2].

Biological Activity
The ED50 is <0.05 ng/mL as measured by L-929 mouse fibrosarcoma cells, corresponding to a specific activity of >2 × 107 units/mg.
Species

Mouse

Source

E. coli

Tag

His

Accession

P06804 (L80-L235)

Gene ID

21926  [NCBI]

Synonyms
rMuTNF-α, His; Cachectin; TNFSF2
AA Sequence

MHHHHHHMLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Molecular Weight

Approximately 18.3 kDa

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<1.0 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNF-alpha/TNFSF2 Protein, Mouse (His)
Cat. No.:
HY-P7417
Quantity:
MCE Japan Authorized Agent: