1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. TNFAIP3 Protein, Human (Active, GST, His)

TNFAIP3 Protein, Human (Active, GST, His) is the recombinant human-derived TNFAIP3, expressed by E. coli , with His, GST labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TNFAIP3 Protein, Human (Active, GST, His) is the recombinant human-derived TNFAIP3, expressed by E. coli , with His, GST labeled tag. ,

Background

TNFAIP3 is a ubiquitin-editing enzyme with both ubiquitin ligase and deubiquitinase activities, involved in immune and inflammatory responses triggered by cytokines such as TNF-alpha and IL-1 beta or pathogens via Toll-like receptors (TLRs) by terminating NF-kappa-B activity. It is an essential component of a ubiquitin-editing protein complex, including RNF11, ITCH, and TAX1BP1, ensuring the transient nature of inflammatory signaling pathways. In cooperation with TAX1BP1, it promotes disassembly of E2-E3 ubiquitin protein ligase complexes in IL-1R and TNFR-1 pathways, affecting at least E3 ligases TRAF6, TRAF2, and BIRC2, as well as E2 ubiquitin-conjugating enzymes UBE2N and UBE2D3. Upon TNF stimulation, it deubiquitinates 'Lys-63'-polyubiquitin chains on RIPK1 and catalyzes 'Lys-48'-polyubiquitin chain formation, leading to RIPK1 proteasomal degradation and termination of TNF- or LPS-mediated NF-kappa-B activation. It also deubiquitinates TRAF6, likely acting on 'Lys-63'-linked polyubiquitin. During TCR-mediated T-cell activation, it deubiquitinates 'Lys-63'-polyubiquitin chains on MALT1, mediating disassociation of the CBM (CARD11:BCL10:MALT1) and IKK complexes to prevent sustained IKK activation. Additionally, it deubiquitinates NEMO/IKBKG, facilitated by TNIP1, inhibiting NF-kappa-B activation. Upon bacterial peptidoglycan stimulation, it likely deubiquitinates RIPK2. It can also inhibit I-kappa-B-kinase (IKK) non-catalytically via polyubiquitin, which promotes association with IKBKG and blocks IKK MAP3K7-mediated phosphorylation. It targets TRAF2 for lysosomal degradation and, in vitro, deubiquitinates 'Lys-11'-, 'Lys-48'-, and 'Lys-63'-polyubiquitin chains. As an inhibitor of programmed cell death, it plays a role in lymphoid system function and is required for LPS-induced pro-inflammatory cytokine and IFN beta production in LPS-tolerized macrophages.

Biological Activity

The biological activity is measured by it's ability to deubiquitinate substrate Ub-rho-110 at different concentrations.

Species

Human

Source

E. coli

Tag

His;GST

Accession

P21580 (A2-E366)

Gene ID

7128

Protein Length

Partial

Synonyms
OTUD7C
AA Sequence

AEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRNIQATLESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDLVLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTDTPMARSGLQYNSLEEIHIFVLCNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHWPAQECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDRGRFEDLKVHFLTDPENEMKEKLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENSEQGRRE

Molecular Weight

Approximately 60-70 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

TNFAIP3 Protein, Human (Active, GST, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TNFAIP3 Protein, Human (Active, GST, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNFAIP3 Protein, Human (Active, GST, His)
Cat. No.:
HY-P703593
Quantity:
MCE Japan Authorized Agent: