TNFAIP3 Protein, Human (Active, GST, His)
Based on 1 Customer Validation
TNFAIP3 Protein, Human (Active, GST, His) is the recombinant human-derived TNFAIP3, expressed by E. coli , with His, GST labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
TNFAIP3 Protein, Human (Active, GST, His) is the recombinant human-derived TNFAIP3, expressed by E. coli , with His, GST labeled tag. ,
Background
TNFAIP3 is a ubiquitin-editing enzyme with both ubiquitin ligase and deubiquitinase activities, involved in immune and inflammatory responses triggered by cytokines such as TNF-alpha and IL-1 beta or pathogens via Toll-like receptors (TLRs) by terminating NF-kappa-B activity. It is an essential component of a ubiquitin-editing protein complex, including RNF11, ITCH, and TAX1BP1, ensuring the transient nature of inflammatory signaling pathways. In cooperation with TAX1BP1, it promotes disassembly of E2-E3 ubiquitin protein ligase complexes in IL-1R and TNFR-1 pathways, affecting at least E3 ligases TRAF6, TRAF2, and BIRC2, as well as E2 ubiquitin-conjugating enzymes UBE2N and UBE2D3. Upon TNF stimulation, it deubiquitinates 'Lys-63'-polyubiquitin chains on RIPK1 and catalyzes 'Lys-48'-polyubiquitin chain formation, leading to RIPK1 proteasomal degradation and termination of TNF- or LPS-mediated NF-kappa-B activation. It also deubiquitinates TRAF6, likely acting on 'Lys-63'-linked polyubiquitin. During TCR-mediated T-cell activation, it deubiquitinates 'Lys-63'-polyubiquitin chains on MALT1, mediating disassociation of the CBM (CARD11:BCL10:MALT1) and IKK complexes to prevent sustained IKK activation. Additionally, it deubiquitinates NEMO/IKBKG, facilitated by TNIP1, inhibiting NF-kappa-B activation. Upon bacterial peptidoglycan stimulation, it likely deubiquitinates RIPK2. It can also inhibit I-kappa-B-kinase (IKK) non-catalytically via polyubiquitin, which promotes association with IKBKG and blocks IKK MAP3K7-mediated phosphorylation. It targets TRAF2 for lysosomal degradation and, in vitro, deubiquitinates 'Lys-11'-, 'Lys-48'-, and 'Lys-63'-polyubiquitin chains. As an inhibitor of programmed cell death, it plays a role in lymphoid system function and is required for LPS-induced pro-inflammatory cytokine and IFN beta production in LPS-tolerized macrophages.
Verified Bioactivity
The biological activity is measured by it's ability to deubiquitinate substrate Ub-rho-110 at different concentrations.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag His;GST
-
Accession
P21580 (A2-E366)
-
Gene ID7128
-
Protein Length
Partial
-
Synonyms
TNFAIP3; Tumor Necrosis Factor, Alpha-Induced Protein 3; TNF Alpha Induced Protein 3; Tumor Necrosis Factor, Alpha Induced Protein 3; OTUD7C; Tumor Necrosis Factor Inducible Protein A20; Tumor Necrosis Factor Alpha-Induced Protein 3; TNF Alpha-Induced Pro
-
AA Sequence
AEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRNIQATLESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDLVLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTDTPMARSGLQYNSLEEIHIFVLCNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHWPAQECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDRGRFEDLKVHFLTDPENEMKEKLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENSEQGRRE
-
Molecular Weight
Approximately 60-70 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)