TNFAIP3 Protein, Human (Active, GST, His)

Customer Review

Based on 1 Customer Validation

TNFAIP3 Protein, Human (Active, GST, His) is the recombinant human-derived TNFAIP3, expressed by E. coli , with His, GST labeled tag. ,

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TNFAIP3 Protein, Human (Active, GST, His) is the recombinant human-derived TNFAIP3, expressed by E. coli , with His, GST labeled tag. ,

Background

TNFAIP3 is a ubiquitin-editing enzyme with both ubiquitin ligase and deubiquitinase activities, involved in immune and inflammatory responses triggered by cytokines such as TNF-alpha and IL-1 beta or pathogens via Toll-like receptors (TLRs) by terminating NF-kappa-B activity. It is an essential component of a ubiquitin-editing protein complex, including RNF11, ITCH, and TAX1BP1, ensuring the transient nature of inflammatory signaling pathways. In cooperation with TAX1BP1, it promotes disassembly of E2-E3 ubiquitin protein ligase complexes in IL-1R and TNFR-1 pathways, affecting at least E3 ligases TRAF6, TRAF2, and BIRC2, as well as E2 ubiquitin-conjugating enzymes UBE2N and UBE2D3. Upon TNF stimulation, it deubiquitinates 'Lys-63'-polyubiquitin chains on RIPK1 and catalyzes 'Lys-48'-polyubiquitin chain formation, leading to RIPK1 proteasomal degradation and termination of TNF- or LPS-mediated NF-kappa-B activation. It also deubiquitinates TRAF6, likely acting on 'Lys-63'-linked polyubiquitin. During TCR-mediated T-cell activation, it deubiquitinates 'Lys-63'-polyubiquitin chains on MALT1, mediating disassociation of the CBM (CARD11:BCL10:MALT1) and IKK complexes to prevent sustained IKK activation. Additionally, it deubiquitinates NEMO/IKBKG, facilitated by TNIP1, inhibiting NF-kappa-B activation. Upon bacterial peptidoglycan stimulation, it likely deubiquitinates RIPK2. It can also inhibit I-kappa-B-kinase (IKK) non-catalytically via polyubiquitin, which promotes association with IKBKG and blocks IKK MAP3K7-mediated phosphorylation. It targets TRAF2 for lysosomal degradation and, in vitro, deubiquitinates 'Lys-11'-, 'Lys-48'-, and 'Lys-63'-polyubiquitin chains. As an inhibitor of programmed cell death, it plays a role in lymphoid system function and is required for LPS-induced pro-inflammatory cytokine and IFN beta production in LPS-tolerized macrophages.

Verified Bioactivity

The biological activity is measured by it's ability to deubiquitinate substrate Ub-rho-110 at different concentrations.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag His;GST
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    TNFAIP3; Tumor Necrosis Factor, Alpha-Induced Protein 3; TNF Alpha Induced Protein 3; Tumor Necrosis Factor, Alpha Induced Protein 3; OTUD7C; Tumor Necrosis Factor Inducible Protein A20; Tumor Necrosis Factor Alpha-Induced Protein 3; TNF Alpha-Induced Pro

  • AA Sequence

    AEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRNIQATLESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDLVLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTDTPMARSGLQYNSLEEIHIFVLCNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHWPAQECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDRGRFEDLKVHFLTDPENEMKEKLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENSEQGRRE

  • Molecular Weight

    Approximately 60-70 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00