Copy Link Print Information

TNFAIP8 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

TNFAIP8 Protein functions as a negative regulator of apoptosis, inhibiting caspase-8 activity and suppressing TNF-mediated apoptosis without affecting procaspase-8 processing.This control prevents BID cleavage and subsequent caspase-3 activation, contributing to cellular survival mechanisms.TNFAIP8's role highlights its potential significance in apoptosis regulation and its implications for tumor development.TNFAIP8 Protein, Human (His) is the recombinant human-derived TNFAIP8 protein, expressed by E.coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • TNFAIP8 Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TNFAIP8 Protein functions as a negative regulator of apoptosis, inhibiting caspase-8 activity and suppressing TNF-mediated apoptosis without affecting procaspase-8 processing.This control prevents BID cleavage and subsequent caspase-3 activation, contributing to cellular survival mechanisms.TNFAIP8's role highlights its potential significance in apoptosis regulation and its implications for tumor development.TNFAIP8 Protein, Human (His) is the recombinant human-derived TNFAIP8 protein, expressed by E.coli , with N-His labeled tag.

Background

TNFAIP8 Protein serves as a negative regulator of apoptosis and is implicated in tumor progression. Its functional role involves the suppression of TNF-mediated apoptosis through the inhibition of caspase-8 activity, while not affecting the processing of procaspase-8. This, in turn, leads to the prevention of BID cleavage and the subsequent activation of caspase-3. By exerting control over key components in the apoptotic pathway, TNFAIP8 contributes to cellular survival mechanisms, emphasizing its potential significance in the context of apoptosis regulation and its implications for tumor development.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    O95379-1 (M1-I198)

  • Gene ID
    25816  [NCBI]
  • Molecular Construction
    • N-term
    • His
    • TNFAIP8 (M1-I198)
      Accession # O95379
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    TNFAIP8; NF-Kappa-B-Inducible DED-Containing Protein; TNF Alpha Induced Protein 8; TNF-Induced Protein GG2-1; MDC-3.13; NDED; SCC-S2; Tumor Necrosis Factor, Alpha-Induced Protein 8; Tumor Necrosis Factor Alpha-Induced Protein 8; Tumor Necrosis Factor, Alp

  • AA Sequence

    MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI

  • Predicted Molecular Mass

    23 kDa

  • Molecular Weight

    Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.0, 10% glycerol, 10% trehalose, 0.02% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • TNFAIP8 Protein, Human (His) Product Image
    1/16
  • TNFAIP8 Protein, Human (His) Product Image