Copy Link Print Information

TNFRSF11B/OPG Protein, Rhesus Macaque (HEK293, hFc)

Customer Review

Based on 1 Customer Validation

Osteoprotegerin (OPG), a TNF receptor superfamily, is expressed in many tissues including heart, kidney, liver, spleen, and bone marrow. Osteoprotegerin has osteoprotective effect and is critical in bone remodeling. Osteoprotegerin can bind to RANKL and inhibit the binding between TNFSF11 and RANKL, thereby neutralizing the RANKL function in osteoclastogenesis. OPG is also involved in multiple biological processes of cancers. TNFRSF11B/OPG Protein, Rhesus Macaque (HEK293, hFc) is a recombinant Rhesus Macaque TNFRSF11B/OPG (M28-L428) with C-terminal hFc tag, which is produced in HEK293 cell.

For research use only. We do not sell to patients.
  • Species: Rhesus Macaque
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for TNFRSF11B/OPG Protein, Rhesus Macaque (HEK293, hFc)
  • Experimental Validation Results for TNFRSF11B/OPG Protein, Rhesus Macaque (HEK293, hFc)
  • TNFRSF11B/OPG Protein, Rhesus Macaque (HEK293, hFc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Osteoprotegerin (OPG), a TNF receptor superfamily, is expressed in many tissues including heart, kidney, liver, spleen, and bone marrow. Osteoprotegerin has osteoprotective effect and is critical in bone remodeling. Osteoprotegerin can bind to RANKL and inhibit the binding between TNFSF11 and RANKL, thereby neutralizing the RANKL function in osteoclastogenesis[1]. OPG is also involved in multiple biological processes of cancers. TNFRSF11B/OPG Protein, Rhesus Macaque (HEK293, hFc) is a recombinant Rhesus Macaque TNFRSF11B/OPG (M28-L428) with C-terminal hFc tag, which is produced in HEK293 cell[1][2].

Background

Osteoprotegerin (OPG), a glycoprotein, belongs to TNF receptor superfamily. OPG is expressed in many tissues besides osteoblasts, including heart, kidney, liver, spleen, and bone marrow. Human osteoprotegerin shares <85% aa sequence identity with mouse and rat. Mouse OX40 shares 94.5% aa sequence identity with rat[1].
Osteoprotegerin can bind to RANKL and inhibit the binding between TNFSF11 and RANKL, thereby neutralizing the RANKL function in osteoclastogenesis. Osteoprotegerin also protects large blood vessels from medial calcification. Increased osteoprotegerin levels have been consistently associated with the incidence and prevalence of coronary artery disease[1][3]. Osteoprotegerin is also involved in multiple processes of cancers, such as tumor survival, epithelial to mesenchymal transition (EMT), neo-angiogenesis, invasion, and metastasis[2].
Osteoprotegerin plays a critical role in bone remodeling, and has osteoprotective effect[1].

In Vitro

RANKL (human, -1 pg/mL, 36 h) promotes the proliferation of VSMC[5].

In Vivo

Osteoprotegerin (human, 5 mg/kg, i.v.) shows antiresorptive effects in rats[4].

Verified Bioactivity

Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L 929 mouse fibroblast cells treated with TRAIL. The ED50 for this effect is 6.472 ng/mL in the presence of 20 ng/mL of recombinant human TRAIL, corresponding to a specific activity is 1.545×10[5] units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L 929 mouse fibroblast cells treated with TRAIL.The ED50 for this effect is 6.472 ng/mL in the presence of 20 ng/mL of recombinant human TRAIL, corresponding to a specific activity is 1.545×105 units/mg.

Technical Parameters

  • Species Rhesus Macaque
  • Source HEK293
  • Tag C-hFc
  • Accession

    XP_001096915 (M28-L428)

  • Gene ID
    701850  [NCBI]
  • Molecular Construction
    • N-term
    • TNFRSF11B (M28-L428)
      Accession # XP_001096915
    • hFc
    • C-term
  • Protein Length

    Partial

  • Synonyms

    TNFRSF11B; Osteoprotegerin; Prev. OPG; Tumor Necrosis Factor Receptor Superfamily, Member 11b; OCIF; Tumor Necrosis Factor Receptor Superfamily Member 11B; Osteoclastogenesis Inhibitory Factor; PDB5; TNF Receptor Superfamily Member 11b; TR1

  • AA Sequence

    MNKLLCCALVFLDISIKWTTQETFPPKYLHYDQETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRRHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTTKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL

  • Predicted Molecular Mass

    72.1 kDa

  • Molecular Weight

    Approximately 80-95 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Boyce BF, et al. Biology of RANK, RANKL, and osteoprotegerin. Arthritis Res Ther. 2007;9 Suppl 1(Suppl 1):S1. [Content Brief]

[2]. Wang Y, et al. The roles of osteoprotegerin in cancer, far beyond a bone player. Cell Death Discov. 2022 May 6;8(1):252. [Content Brief]

[3]. Venuraju SM, et al. Osteoprotegerin as a predictor of coronary artery disease and cardiovascular mortality and morbidity. J Am Coll Cardiol. 2010 May 11;55(19):2049-61. [Content Brief]

[4]. Capparelli C, et al. Sustained antiresorptive effects after a single treatment with human recombinant osteoprotegerin (OPG): a pharmacodynamic and pharmacokinetic analysis in rats. J Bone Miner Res. 2003 May;18(5):852-8. [Content Brief]

[5]. Candido R, et al. Human full-length osteoprotegerin induces the proliferation of rodent vascular smooth muscle cells both in vitro and in vivo. J Vasc Res. 2010;47(3):252-61. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L 929 mouse fibroblast cells treated with TRAIL.The ED50 for this effect is 6.472 ng/mL in the presence of 20 ng/mL of recombinant human TRAIL, corresponding to a specific activity is 1.545×105 units/mg.

  • TNFRSF11B/OPG Protein, Rhesus Macaque (HEK293, hFc) Product Image
    1/16
  • Experimental Validation Results for TNFRSF11B/OPG Protein, Rhesus Macaque (HEK293, hFc)
  • Experimental Validation Results for TNFRSF11B/OPG Protein, Rhesus Macaque (HEK293, hFc)
  • TNFRSF11B/OPG Protein, Rhesus Macaque (HEK293, hFc) Product Image