TRAIL R2/TNFRSF10B Protein, Human (HEK293, hFc)
Based on 1 Customer Validation
TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and recruits caspase-8 through FADD to initiate cell apoptosis. It forms the death-inducing signaling complex (DISC), activates caspases and mediates apoptosis. TRAIL R2/TNFRSF10B Protein, Human (HEK293, hFc) is the recombinant human-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and recruits caspase-8 through FADD to initiate cell apoptosis. It forms the death-inducing signaling complex (DISC), activates caspases and mediates apoptosis. TRAIL R2/TNFRSF10B Protein, Human (HEK293, hFc) is the recombinant human-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.
Background
The TRAIL R2/TNFRSF10B Protein functions as a receptor for the cytotoxic ligand TNFSF10/TRAIL. Upon ligand binding, the adapter molecule FADD recruits caspase-8 to the activated receptor, forming the death-inducing signaling complex (DISC), which triggers caspase-8 proteolytic activation and initiates the subsequent cascade of caspases, mediating apoptosis. Additionally, TRAIL R2/TNFRSF10B promotes the activation of NF-kappa-B and is essential for endoplasmic reticulum (ER) stress-induced apoptosis. In its monomeric state, it can interact with TRADD and RIPK1, and in the absence of stimulation, it interacts with BIRC2, DDX3X, and GSK3B. Stimulation of the receptor enhances interactions with BIRC2 and DDX3X, accompanied by their cleavage. Notably, TRAIL R2/TNFRSF10B can also interact with the HCMV protein UL141, preventing cell surface expression, where two TNFRSF10B monomers interact with a UL141 homodimer, and three TNFRSF10B molecules interact with TNFSF10 homotrimer. These intricate interactions underline the multifaceted role of TRAIL R2/TNFRSF10B in apoptotic and signaling pathways.
Verified Bioactivity
Label Recombinant Human TNFSF10 / TRAIL / APO-2L / CD253 Protein with biotin. Immobilized Recombinant Human TRAIL R2 / CD262 / TNFRSF10B Protein(Fc Tag) at 5 μg/mL (100 μL/well) can bind biotinylated Recombinant Human TNFSF10 / TRAIL / APO-2L / CD253 Protein, the EC50 is 21.11 ng/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
O14763 (I56-E182)
-
Molecular Construction
-
N-term
-
TRAIL-R2 (I56-E182)
Accession # O14763 -
hFc
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
TNFRSF10B; ZTNFR9; TNF Receptor Superfamily Member 10b; CDNA FLJ76289, Highly Similar To Homo Sapiens Tumor Necrosis Factor Receptor Superfamily, Member 10b (TNFRSF10B), Transcript Variant 1, MRNA; TRAIL-R2; P53-Regulated DNA Damage-Inducible Cell Death R
-
AA Sequence
ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE
-
Predicted Molecular Mass
41 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)