TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, His)
TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC).It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, His) TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, His) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC).It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, His) TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, His) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-His labeled tag.
Background
TRAIL R2/TNFRSF10B Protein serves as a receptor for the cytotoxic ligand TNFSF10/TRAIL. Upon ligand binding, the adapter molecule FADD recruits caspase-8 to the activated receptor, leading to the formation of the death-inducing signaling complex (DISC). The DISC performs caspase-8 proteolytic activation, initiating a cascade of caspases that mediate apoptosis. Additionally, TRAIL R2/TNFRSF10B promotes the activation of NF-kappa-B and is essential for ER stress-induced apoptosis. In its monomeric form, it can interact with TRADD and RIPK1, and three TNFRSF10B molecules interact with the TNFSF10 homotrimer. In the absence of stimulation, TRAIL R2/TNFRSF10B interacts with BIRC2, DDX3X, and GSK3B, with enhanced interactions observed upon receptor stimulation, accompanied by DDX3X and BIRC2 cleavage (By similarity).
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-8*His
-
Accession
Q9QZM4 (N53-K180)
-
Molecular Construction
-
N-term
-
TRAIL-R2 (N53-K180)
Accession # Q9QZM4 -
8*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
TNFRSF10B; ZTNFR9; TNF Receptor Superfamily Member 10b; CDNA FLJ76289, Highly Similar To Homo Sapiens Tumor Necrosis Factor Receptor Superfamily, Member 10b (TNFRSF10B), Transcript Variant 1, MRNA; TRAIL-R2; P53-Regulated DNA Damage-Inducible Cell Death R
-
AA Sequence
NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWASWHK
-
Predicted Molecular Mass
15.3 kDa
-
Molecular Weight
Approximately 25-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
