TRAILR4/TNFRSF10D Protein, Human (Biotinylated, HEK293, His-Avi)
Based on 1 Customer Validation
TRAILR4/TNFRSF10D protein is a receptor for TRAIL and lacks the ability to induce apoptosis due to the truncated death domain. Paradoxically, not only does it fail to induce apoptosis, but it also prevents TRAIL-mediated apoptosis. TRAILR4/TNFRSF10D Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived TRAILR4/TNFRSF10D protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
TRAILR4/TNFRSF10D protein is a receptor for TRAIL and lacks the ability to induce apoptosis due to the truncated death domain. Paradoxically, not only does it fail to induce apoptosis, but it also prevents TRAIL-mediated apoptosis. TRAILR4/TNFRSF10D Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived TRAILR4/TNFRSF10D protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
The TRAILR4/TNFRSF10D Protein functions as a receptor for the cytotoxic ligand TRAIL, although it contains a truncated death domain, rendering it incapable of inducing apoptosis. Paradoxically, TRAILR4/TNFRSF10D not only fails to induce apoptosis but also serves a protective role against TRAIL-mediated apoptosis. There is conflicting information regarding its ability to activate the NF-kappa-B pathway, with some studies suggesting that it cannot induce this pathway, while others propose that it has the capability to activate NF-kappa-B. The dual nature of TRAILR4/TNFRSF10D in interacting with TRAIL, both as a receptor and as a protective factor against apoptosis, underscores the complexity of its regulatory functions in cellular responses to TRAIL signaling.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When immobilized Human TRAIL at 2 μg/mL (100μl/Well), can bind Human TRAIL at 2 μg/mL and the EC50 is 0.16 ug/ml.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-6*His
-
Accession
Q9UBN6 (A56-H211)
-
Molecular Construction
-
N-term
-
TRAIL (A56-H211)
Accession # Q9UBN6 -
6*His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Conjugate Method
The single lysine residue in Avitag is biotinylated through an enzymatic reaction.
-
Synonyms
TNFRSF10D; TNF-Related Apoptosis-Inducing Ligand Receptor 4; TNF Receptor Superfamily Member 10d; TRAIL Receptor With A Truncated Death Domain; TRAILR4; TRAIL Receptor 4; TRUNDD; Decoy Receptor 2; DcR2; TRAIL-R4; CD264; TNF Receptor-Related Receptor For T
-
AA Sequence
ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYH
-
Predicted Molecular Mass
19.4 kDa
-
Molecular Weight
Approximately 38-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)