TRAILR4/TNFRSF10D Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

TRAILR4/TNFRSF10D protein is a receptor for TRAIL and lacks the ability to induce apoptosis due to the truncated death domain. Paradoxically, not only does it fail to induce apoptosis, but it also prevents TRAIL-mediated apoptosis. TRAILR4/TNFRSF10D Protein, Human (HEK293, His) is the recombinant human-derived TRAILR4/TNFRSF10D protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TRAILR4/TNFRSF10D protein is a receptor for TRAIL and lacks the ability to induce apoptosis due to the truncated death domain. Paradoxically, not only does it fail to induce apoptosis, but it also prevents TRAIL-mediated apoptosis. TRAILR4/TNFRSF10D Protein, Human (HEK293, His) is the recombinant human-derived TRAILR4/TNFRSF10D protein, expressed by HEK293 , with C-His labeled tag.

Background

The TRAILR4/TNFRSF10D Protein functions as a receptor for the cytotoxic ligand TRAIL, although it contains a truncated death domain, rendering it incapable of inducing apoptosis. Paradoxically, TRAILR4/TNFRSF10D not only fails to induce apoptosis but also serves a protective role against TRAIL-mediated apoptosis. There is conflicting information regarding its ability to activate the NF-kappa-B pathway, with some studies suggesting that it cannot induce this pathway, while others propose that it has the capability to activate NF-kappa-B. The dual nature of TRAILR4/TNFRSF10D in interacting with TRAIL, both as a receptor and as a protective factor against apoptosis, underscores the complexity of its regulatory functions in cellular responses to TRAIL signaling.

Verified Bioactivity

1.Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL. The ED50 for this effect is 20.99 ng/mL in the presence of 20 ng/mL of rhTRAIL, corresponding to a specific activity is 4.76 ×104 units/mg.
2.Recombinant Human TRAIL R4 immobilized on CM5 Chip can bind Human TRAIL with an affinity constant of 0.05-0.5 nM as determined in a SPR assay.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL. The ED50 for this effect is 20.99 ng/mL in the presence of 20 ng/mL of rhTRAIL, corresponding to a specific activity is 4.76 ×104 units/mg.

  • Bioactivity - SPR

    Bioactivity - SPR

    Recombinant Human TRAIL R4 immobilized on CM5 Chip can bind Human TRAIL with an affinity constant of 0.13 nM as determined in a SPR assay.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • TRAIL (A56-H211)
      Accession # Q9UBN6
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    TNFRSF10D; TNF-Related Apoptosis-Inducing Ligand Receptor 4; TNF Receptor Superfamily Member 10d; TRAIL Receptor With A Truncated Death Domain; TRAILR4; TRAIL Receptor 4; TRUNDD; Decoy Receptor 2; DcR2; TRAIL-R4; CD264; TNF Receptor-Related Receptor For T

  • AA Sequence

    ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYH

  • Predicted Molecular Mass

    16.8 kDa

  • Molecular Weight

    Approximately 23-42 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00