Copy Link Print Information

Transthyretin/TTR Protein, Mouse (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The transthyretin/TTR protein is a thyroid hormone binder that may transport thyroxine from the blood to the brain.It exists as a homotetramer forming a dimer of dimers with a ligand-regulated central channel suggested to play a role in thyroxine binding and transport.Transthyretin/TTR Protein, Mouse (HEK293, His) is the recombinant mouse-derived Transthyretin/TTR protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Transthyretin/TTR Protein, Mouse (HEK293, His)
  • Experimental Validation Results for Transthyretin/TTR Protein, Mouse (HEK293, His)
  • Transthyretin/TTR Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The transthyretin/TTR protein is a thyroid hormone binder that may transport thyroxine from the blood to the brain.It exists as a homotetramer forming a dimer of dimers with a ligand-regulated central channel suggested to play a role in thyroxine binding and transport.Transthyretin/TTR Protein, Mouse (HEK293, His) is the recombinant mouse-derived Transthyretin/TTR protein, expressed by HEK293 , with C-10*His labeled tag.

Background

Transthyretin/TTR Protein, a thyroid hormone-binding protein, likely facilitates the transport of thyroxine from the bloodstream to the brain. Existing as a homotetramer, it forms a dimer of dimers, with subunits assembling around a central channel capable of accommodating two ligand molecules. This structural arrangement suggests a role in the binding and transport of thyroxine. Furthermore, Transthyretin/TTR Protein interacts with RBP4, indicating potential functional associations and interplay in the context of thyroid hormone regulation. The homotetrameric configuration and ligand-binding capabilities underscore the significance of Transthyretin/TTR in facilitating the transport and distribution of thyroid hormones within the body.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized recombinant human TTR-His at 10 μg/mL (100 μL/well) can bind recombinant Canine RBP4, the ED50 for this effect is 1.876 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized recombinant human TTR-His at 10 μg/mL (100 μl/well) can bind recombinant Canine RBP4, The ED50 for this effect is 1.876 μg/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-10*His
  • Accession

    P07309 (G21-N147)

  • Gene ID
    22139  [NCBI]
  • Molecular Construction
    • N-term
    • TTR (G21-N147)
      Accession # P07309
    • 10*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    TTR; Transthyretin; PALB; CTS1; HsT2651; CTS; Prealbumin, Amyloidosis Type I; ATTR; TBPA; Epididymis Luminal Protein 111; Thyroxine-Binding Prealbumin; Carpal Tunnel Syndrome 1; TTR Protein; Prealbumin; AMYLD1; HEL111; TTN

  • AA Sequence

    GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN

  • Predicted Molecular Mass

    16.4 kDa

  • Molecular Weight

    Approximately 17-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 500 mM NaCl, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized recombinant human TTR-His at 10 μg/mL (100 μl/well) can bind recombinant Canine RBP4, The ED50 for this effect is 1.876 μg/mL.

  • Transthyretin/TTR Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Transthyretin/TTR Protein, Mouse (HEK293, His)
  • Experimental Validation Results for Transthyretin/TTR Protein, Mouse (HEK293, His)
  • Transthyretin/TTR Protein, Mouse (HEK293, His) Product Image