TRAP1 Protein, Rat

TRAP1 Protein, Rat is the recombinant rat-derived TRAP1, expressed by E. coli , with tag Free labeled tag. ,

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: E. coli
  • Biological Activity
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TRAP1 Protein, Rat is the recombinant rat-derived TRAP1, expressed by E. coli , with tag Free labeled tag. ,

Background

TRAP1 (TNF receptor-associated protein 1) serves as a chaperone with ATPase activity and is integral in preserving mitochondrial function and polarization, functioning downstream of PINK1 and mitochondrial complex I. It acts as a negative regulator of mitochondrial respiration, dynamically influencing the balance between oxidative phosphorylation and aerobic glycolysis. TRAP1's impact on mitochondrial respiration is likely mediated through the modulation of mitochondrial SRC and inhibition of SDHA. Furthermore, TRAP1 interacts with diverse cellular components, including binding to the intracellular domain of the tumor necrosis factor type 1 receptor, forming complexes with RB1, and engaging with SRC and SDHA. These interactions underscore the multifaceted nature of TRAP1's involvement in cellular processes (

Technical Parameters

  • Species Rat
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    Hsp75; Hspc5

  • AA Sequence

    STQAAEDKKEEALHSIISNTEAVQGSVSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKRVCEGQVLPEMEIHLQTDAEKGTITIQDTGIGMTKEELVSNLGTIARSGSKAFLEALQHQAETSSRIIGQFGVGFYSAFMVADKVEVYSRPAAPESPGYQWLSDGSGVFEIAEASGVRPGTKIIIHLKSDCKDFANESRVQDVVTKYSNFVSFPLYLNGRRINTLQAIWMMDPKDISEFQHEEFYRYIAQAYDKPRFILHYKTDAPLNIRSIFYVPEMKPSMFDVSRELGSSVALYSRKVLIQTKATDILPKWLRFVRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQRLIKFFIDQSKKDAEKYAKFFEDYGLFMREGIVTTAEQDIKEDIAKLLRYESSALPAGQLTSLSDYASRMQAGTRNIYYLCAPNRHLAEHSPYYEAMKQKQTEVLFCYEQFDELTLLHLREFDKKKLISVETDIVVDHYKE

  • Predicted Molecular Mass

    57.6 kDa

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00