TRAP1 Protein, Rat
TRAP1 Protein, Rat is the recombinant rat-derived TRAP1, expressed by E. coli , with tag Free labeled tag. ,
- Species: Rat
- Source: E. coli
Biological Activity
TRAP1 Protein, Rat is the recombinant rat-derived TRAP1, expressed by E. coli , with tag Free labeled tag. ,
TRAP1 (TNF receptor-associated protein 1) serves as a chaperone with ATPase activity and is integral in preserving mitochondrial function and polarization, functioning downstream of PINK1 and mitochondrial complex I. It acts as a negative regulator of mitochondrial respiration, dynamically influencing the balance between oxidative phosphorylation and aerobic glycolysis. TRAP1's impact on mitochondrial respiration is likely mediated through the modulation of mitochondrial SRC and inhibition of SDHA. Furthermore, TRAP1 interacts with diverse cellular components, including binding to the intracellular domain of the tumor necrosis factor type 1 receptor, forming complexes with RB1, and engaging with SRC and SDHA. These interactions underscore the multifaceted nature of TRAP1's involvement in cellular processes (
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag Tag Free
-
Accession
Q5XHZ0 (S61-E563)
-
Gene ID287069
-
Protein Length
Partial
-
Synonyms
Hsp75; Hspc5
-
AA Sequence
STQAAEDKKEEALHSIISNTEAVQGSVSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKRVCEGQVLPEMEIHLQTDAEKGTITIQDTGIGMTKEELVSNLGTIARSGSKAFLEALQHQAETSSRIIGQFGVGFYSAFMVADKVEVYSRPAAPESPGYQWLSDGSGVFEIAEASGVRPGTKIIIHLKSDCKDFANESRVQDVVTKYSNFVSFPLYLNGRRINTLQAIWMMDPKDISEFQHEEFYRYIAQAYDKPRFILHYKTDAPLNIRSIFYVPEMKPSMFDVSRELGSSVALYSRKVLIQTKATDILPKWLRFVRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQRLIKFFIDQSKKDAEKYAKFFEDYGLFMREGIVTTAEQDIKEDIAKLLRYESSALPAGQLTSLSDYASRMQAGTRNIYYLCAPNRHLAEHSPYYEAMKQKQTEVLFCYEQFDELTLLHLREFDKKKLISVETDIVVDHYKE
-
Predicted Molecular Mass
57.6 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)