1. Recombinant Proteins
  2. Others
  3. TRAP1 Protein, Rat

TRAP1 Protein, Rat is the recombinant rat-derived TRAP1, expressed by E. coli , with tag Free labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TRAP1 Protein, Rat is the recombinant rat-derived TRAP1, expressed by E. coli , with tag Free labeled tag. ,

Background

TRAP1 (TNF receptor-associated protein 1) serves as a chaperone with ATPase activity and is integral in preserving mitochondrial function and polarization, functioning downstream of PINK1 and mitochondrial complex I. It acts as a negative regulator of mitochondrial respiration, dynamically influencing the balance between oxidative phosphorylation and aerobic glycolysis. TRAP1's impact on mitochondrial respiration is likely mediated through the modulation of mitochondrial SRC and inhibition of SDHA. Furthermore, TRAP1 interacts with diverse cellular components, including binding to the intracellular domain of the tumor necrosis factor type 1 receptor, forming complexes with RB1, and engaging with SRC and SDHA. These interactions underscore the multifaceted nature of TRAP1's involvement in cellular processes (

Species

Rat

Source

E. coli

Tag

Tag Free

Accession

Q5XHZ0 (S61-E563)

Gene ID

287069

Protein Length

Partial

Synonyms
Hsp75; Hspc5
AA Sequence

STQAAEDKKEEALHSIISNTEAVQGSVSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKRVCEGQVLPEMEIHLQTDAEKGTITIQDTGIGMTKEELVSNLGTIARSGSKAFLEALQHQAETSSRIIGQFGVGFYSAFMVADKVEVYSRPAAPESPGYQWLSDGSGVFEIAEASGVRPGTKIIIHLKSDCKDFANESRVQDVVTKYSNFVSFPLYLNGRRINTLQAIWMMDPKDISEFQHEEFYRYIAQAYDKPRFILHYKTDAPLNIRSIFYVPEMKPSMFDVSRELGSSVALYSRKVLIQTKATDILPKWLRFVRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQRLIKFFIDQSKKDAEKYAKFFEDYGLFMREGIVTTAEQDIKEDIAKLLRYESSALPAGQLTSLSDYASRMQAGTRNIYYLCAPNRHLAEHSPYYEAMKQKQTEVLFCYEQFDELTLLHLREFDKKKLISVETDIVVDHYKE

Predicted Molecular Mass
57.6 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TRAP1 Protein, Rat Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TRAP1 Protein, Rat

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TRAP1 Protein, Rat
Cat. No.:
HY-P703409
Quantity:
MCE Japan Authorized Agent: