TSPAN1 Protein, Human (HEK293, Fc)

TSPAN1 Protein is a member of the tetraspanin (TSPAN/TM4SF) family of proteins whose important feature is their ability to aggregate with one another or various other transmembrane receptors, to become TSPAN-enriched microdomains (TEMs). TSPAN1 functions as an oncoprotein in many cancer types, especially digestive malignancies such as hepatocellular carcinoma (HCC), pancreatic, gastric, colorectal, and esophageal cancers. TSPAN1 is a novel positive regulator of macroautophagy/autophagy characterized by decreased LC3-II and SQSTM1/p62 expressions, inhibited puncta formation of GFP-LC3 and autophagic vacuoles. TSPAN1 Protein, Human (HEK293, Fc) is the recombinant human-derived TSPAN1 protein, expressed by HEK293 , with N-mFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TSPAN1 Protein is a member of the tetraspanin (TSPAN/TM4SF) family of proteins whose important feature is their ability to aggregate with one another or various other transmembrane receptors, to become TSPAN-enriched microdomains (TEMs). TSPAN1 functions as an oncoprotein in many cancer types, especially digestive malignancies such as hepatocellular carcinoma (HCC), pancreatic, gastric, colorectal, and esophageal cancers. TSPAN1 is a novel positive regulator of macroautophagy/autophagy characterized by decreased LC3-II and SQSTM1/p62 expressions, inhibited puncta formation of GFP-LC3 and autophagic vacuoles[1][2][3]. TSPAN1 Protein, Human (HEK293, Fc) is the recombinant human-derived TSPAN1 protein, expressed by HEK293 , with N-mFc labeled tag.

Background

TSPAN1 is upregulated in pancreatic cancer and that TSPAN1 depletion decreases pancreatic cancer cell proliferation in vitro and in vivo. TSPAN1 promoted autophagy maturation via direct binding to LC3 by two conserved LIR motifs. Mutations in the LIR motifs of TSPAN1 resulted in a loss of the ability to induce autophagy and promote pancreatic cancer proliferation[1].
TSPAN1 depletion in parental and CDDP-resistant HNSCC cells reduced cell proliferation, induced apoptosis, decreased autophagy, sensitized to chemotherapeutic agents and inhibited several signaling cascades, with phospho-SRC inhibition being a major common target[2].

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-mFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • mFc
    • TSPAN1 (Y110-N211)
      Accession # O60635
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    TSPAN-1; Tetraspanin TM4-C; NET-1; TM4C; NET1; TM4SF; TSPAN-1; Tetraspanin-1; Tspan-1; Tetraspan 1; Tetraspan NET-1; TSPAN1

  • AA Sequence

    YTTMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTN

  • Predicted Molecular Mass

    38.4 kDa

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00