Copy Link Print Information

uPAR Protein, Mouse (HEK293, His-Fc)

Customer Review

Based on 1 Customer Validation

uPAR (urokinase plasminogen activator receptor) possesses enzyme, protein, and receptor binding activities.It regulates apoptotic signaling, epidermal growth factor signaling, and cytochrome c release.uPAR is widely expressed in structures like decidua and spleen.Its human ortholog, PLAUR, is linked to rheumatoid arthritis.Investigating uPAR can reveal its role in cellular processes and shed light on diseases like rheumatoid arthritis.uPAR Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived uPAR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for uPAR Protein, Mouse (HEK293, His-Fc)
  • Experimental Validation Results for uPAR Protein, Mouse (HEK293, His-Fc)
  • uPAR Protein, Mouse (HEK293, His-Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

uPAR (urokinase plasminogen activator receptor) possesses enzyme, protein, and receptor binding activities.It regulates apoptotic signaling, epidermal growth factor signaling, and cytochrome c release.uPAR is widely expressed in structures like decidua and spleen.Its human ortholog, PLAUR, is linked to rheumatoid arthritis.Investigating uPAR can reveal its role in cellular processes and shed light on diseases like rheumatoid arthritis.uPAR Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived uPAR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Background

uPAR (urokinase plasminogen activator receptor), a multifaceted protein, is predicted to possess enzyme binding activity, protein domain-specific binding activity, and signaling receptor binding activity. It is anticipated to play a role in various processes, including the negative regulation of the apoptotic signaling pathway, positive regulation of the epidermal growth factor receptor signaling pathway, and positive regulation of the release of cytochrome c from mitochondria. As an integral component of the plasma membrane, uPAR exhibits broad expression in diverse structures such as decidua, early conceptus, and spleen. The human ortholog of this gene, PLAUR (plasminogen activator, urokinase receptor), has implications in conditions like rheumatoid arthritis, highlighting the potential significance of uPAR in physiological and pathological contexts. Studies on uPAR may unveil its intricate involvement in cellular processes and contribute to our understanding of diseases like rheumatoid arthritis.

Verified Bioactivity

Immobilized Recombinant rmuPAR/Fc at 5 μg/mL (100 μL/well) can bind Biotinylated Recombinant rhuPA Protein. The ED50 for this effect is <50.73 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized Recombinant rmuPAR/Fc at 5 μg/mL (100 μL/well) can bind Biotinylated Recombinant rhuPA Protein. The ED50 for this effect is 50.73 ng/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-hFc;C-His
  • Accession

    P35456-1/NP_035243.1 (L24-T297)

  • Gene ID
    18793  [NCBI]
  • Molecular Construction
    • N-term
    • uPAR (L24-T297)
      Accession # P35456-1/NP_035243.1
    • hFc-His
    • C-term
  • Protein Length

    Full Length of Partial Extracellular Domain

  • Synonyms

    PLAUR; Monocyte Activation Antigen Mo3; Plasminogen Activator, Urokinase Receptor; U-PAR; Urokinase Plasminogen Activator Surface Receptor; Urokinase Plasminogen Activator Receptor; UPAR; U-Plasminogen Activator Receptor Form 2; URKR; CD87 Antigen; CD87;

  • AA Sequence

    LQCMQCESNQSCLVEECALGQDLCRTTVLREWQDDRELEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRPGARGRAFPQGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSLKDEDYTRGCGSLPGCPGTAGFHSNQTFHFLKCCNYTHCNGGPVLDLQSFPPNGFQCYSCEGNNTLGCSSEEASLINCRGPMNQCLVATGLDVLGNRSYTVRGCATASWCQGSHVADSFPTHLNVSVSCCHGSGCNSPT

  • Molecular Weight

    Approximately 80-90 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Immobilized Recombinant rmuPAR/Fc at 5 μg/mL (100 μL/well) can bind Biotinylated Recombinant rhuPA Protein. The ED50 for this effect is 50.73 ng/mL.

  • uPAR Protein, Mouse (HEK293, His-Fc) Product Image
    1/16
  • Experimental Validation Results for uPAR Protein, Mouse (HEK293, His-Fc)
  • Experimental Validation Results for uPAR Protein, Mouse (HEK293, His-Fc)
  • uPAR Protein, Mouse (HEK293, His-Fc) Product Image