USP8 Protein, Human (sf9)
Based on 1 Customer Validation
USP8 is a key hydrolase in cellular regulation and plays a crucial role in protein turnover by efficiently deubiquitinating proteins and preventing degradation. Its activity spans "Lys-48" and "Lys-63" linked ubiquitin chains, highlighting its versatility. USP8 Protein, Human (sf9) is the recombinant human-derived USP8 protein, expressed by Sf9 insect cells, with tag free.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
USP8 is a key hydrolase in cellular regulation and plays a crucial role in protein turnover by efficiently deubiquitinating proteins and preventing degradation. Its activity spans "Lys-48" and "Lys-63" linked ubiquitin chains, highlighting its versatility. USP8 Protein, Human (sf9) is the recombinant human-derived USP8 protein, expressed by Sf9 insect cells, with tag free.
Background
USP8, a hydrolase with pivotal roles in cellular regulation, serves as a crucial player in protein turnover by effectively removing conjugated ubiquitin from proteins, preventing their degradation. This enzymatic action extends to both 'Lys-48' and 'Lys-63'-linked ubiquitin chains, showcasing its versatility in modulating ubiquitin dynamics. USP8's catalytic activity is notably enhanced during the M phase, underlining its cell cycle-dependent regulatory functions. The enzyme is intricately involved in various cellular processes, including cell proliferation and the response to serum stimulation, where it is required for S phase entry. Additionally, USP8 is implicated in the modulation of T-cell anergy, stabilization of proteins such as STAM2 and RASGRF1, and regulation of endosomal dynamics, cargo sorting, and membrane traffic. Its role in controlling ubiquitination on endosomes is essential for maintaining the organelle's morphology. USP8 further exerts influence on diverse pathways, including acrosome biogenesis, EGFR degradation, MAPK signaling, and the modulation of BACE1-mediated APP cleavage and amyloid-beta formation. The multifaceted functions of USP8 highlight its significance in maintaining cellular homeostasis and orchestrating various signaling cascades.
Verified Bioactivity
The fundamental role of USP8 is specific removal of ubiquitin from substrates. USP8 catalyses the ubiquitin from the substrate Ub-Rho110 to release fluorophores. Rho110 will release 535nM emission light under the excitation condition of 485nM. The signal of which can be quickly and reliably captured using a microplate reader. The concentration of USP8 used is 0.6 nM, and the reaction lasts for 30 minutes. Under these conditions, the signal-to-noise ratio (S/N) of the signal box is greater than or equal to 10.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag Tag Free
-
Accession
P40818-1 (P734-G1110)
-
Gene ID9101
-
Protein Length
Partial
-
Synonyms
USP8; Ubiquitin Specific Peptidase 8; UBPY; Ubiquitin Carboxyl-Terminal Hydrolase 8; Ubiquitin Isopeptidase Y; KIAA0055; HumORF8; SPG59; Ubiquitin-Specific-Processing Protease 8; Deubiquitinating Enzyme 8; Ubiquitin Specific Protease 8; Ubiquitin Thiolest
-
AA Sequence
PTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTSLG
-
Predicted Molecular Mass
43.5 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)