1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. USP8 Protein, Human (sf9)

USP8 is a key hydrolase in cellular regulation and plays a crucial role in protein turnover by efficiently deubiquitinating proteins and preventing degradation. Its activity spans "Lys-48" and "Lys-63" linked ubiquitin chains, highlighting its versatility. USP8 Protein, Human (sf9) is the recombinant human-derived USP8 protein, expressed by Sf9 insect cells, with tag free.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
10 μg En stock
50 μg En stock
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

USP8 is a key hydrolase in cellular regulation and plays a crucial role in protein turnover by efficiently deubiquitinating proteins and preventing degradation. Its activity spans "Lys-48" and "Lys-63" linked ubiquitin chains, highlighting its versatility. USP8 Protein, Human (sf9) is the recombinant human-derived USP8 protein, expressed by Sf9 insect cells, with tag free.

Background

USP8, a hydrolase with pivotal roles in cellular regulation, serves as a crucial player in protein turnover by effectively removing conjugated ubiquitin from proteins, preventing their degradation. This enzymatic action extends to both 'Lys-48' and 'Lys-63'-linked ubiquitin chains, showcasing its versatility in modulating ubiquitin dynamics. USP8's catalytic activity is notably enhanced during the M phase, underlining its cell cycle-dependent regulatory functions. The enzyme is intricately involved in various cellular processes, including cell proliferation and the response to serum stimulation, where it is required for S phase entry. Additionally, USP8 is implicated in the modulation of T-cell anergy, stabilization of proteins such as STAM2 and RASGRF1, and regulation of endosomal dynamics, cargo sorting, and membrane traffic. Its role in controlling ubiquitination on endosomes is essential for maintaining the organelle's morphology. USP8 further exerts influence on diverse pathways, including acrosome biogenesis, EGFR degradation, MAPK signaling, and the modulation of BACE1-mediated APP cleavage and amyloid-beta formation. The multifaceted functions of USP8 highlight its significance in maintaining cellular homeostasis and orchestrating various signaling cascades.

Actividad biológica

The fundamental role of USP8 is specific removal of ubiquitin from substrates. USP8 catalyses the ubiquitin from the substrate Ub-Rho110 to release fluorophores. Rho110 will release 535nM emission light under the excitation condition of 485nM. The signal of which can be quickly and reliably captured using a microplate reader. The concentration of USP8 used is 0.6 nM, and the reaction lasts for 30 minutes. Under these conditions, the signal-to-noise ratio (S/N) of the signal box is greater than or equal to 10.

Species

Human

Source

Sf9 insect cells

Tag

Tag Free

Accession

P40818-1 (P734-G1110)

Gene ID

9101

Protein Length

Partial

Synonyms
Ubiquitin carboxyl-terminal hydrolase 8; Deubiquitinating enzyme 8; Ubiquitin isopeptidase Y (hUBPy); Ubiquitin thioesterase 8; Ubiquitin-specific-processing protease 8; KIAA0055; UBPY
AA Sequence

PTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTSLG

Predicted Molecular Mass
43.5 kDa
Pureza

≥ 80%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Envío

Shipping with dry ice.

Documentación

USP8 Protein, Human (sf9) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

USP8 Protein, Human (sf9)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
USP8 Protein, Human (sf9)
Cat. No.:
HY-P703651
Cantidad:
MCE Japan Authorized Agent: