USP8 Protein, Human (sf9)

Customer Review

Based on 1 Customer Validation

USP8 is a key hydrolase in cellular regulation and plays a crucial role in protein turnover by efficiently deubiquitinating proteins and preventing degradation. Its activity spans "Lys-48" and "Lys-63" linked ubiquitin chains, highlighting its versatility. USP8 Protein, Human (sf9) is the recombinant human-derived USP8 protein, expressed by Sf9 insect cells, with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

USP8 is a key hydrolase in cellular regulation and plays a crucial role in protein turnover by efficiently deubiquitinating proteins and preventing degradation. Its activity spans "Lys-48" and "Lys-63" linked ubiquitin chains, highlighting its versatility. USP8 Protein, Human (sf9) is the recombinant human-derived USP8 protein, expressed by Sf9 insect cells, with tag free.

Background

USP8, a hydrolase with pivotal roles in cellular regulation, serves as a crucial player in protein turnover by effectively removing conjugated ubiquitin from proteins, preventing their degradation. This enzymatic action extends to both 'Lys-48' and 'Lys-63'-linked ubiquitin chains, showcasing its versatility in modulating ubiquitin dynamics. USP8's catalytic activity is notably enhanced during the M phase, underlining its cell cycle-dependent regulatory functions. The enzyme is intricately involved in various cellular processes, including cell proliferation and the response to serum stimulation, where it is required for S phase entry. Additionally, USP8 is implicated in the modulation of T-cell anergy, stabilization of proteins such as STAM2 and RASGRF1, and regulation of endosomal dynamics, cargo sorting, and membrane traffic. Its role in controlling ubiquitination on endosomes is essential for maintaining the organelle's morphology. USP8 further exerts influence on diverse pathways, including acrosome biogenesis, EGFR degradation, MAPK signaling, and the modulation of BACE1-mediated APP cleavage and amyloid-beta formation. The multifaceted functions of USP8 highlight its significance in maintaining cellular homeostasis and orchestrating various signaling cascades.

Verified Bioactivity

The fundamental role of USP8 is specific removal of ubiquitin from substrates. USP8 catalyses the ubiquitin from the substrate Ub-Rho110 to release fluorophores. Rho110 will release 535nM emission light under the excitation condition of 485nM. The signal of which can be quickly and reliably captured using a microplate reader. The concentration of USP8 used is 0.6 nM, and the reaction lasts for 30 minutes. Under these conditions, the signal-to-noise ratio (S/N) of the signal box is greater than or equal to 10.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag Tag Free
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    USP8; Ubiquitin Specific Peptidase 8; UBPY; Ubiquitin Carboxyl‑Terminal Hydrolase 8; Ubiquitin Isopeptidase Y; KIAA0055; HumORF8; SPG59; Ubiquitin‑Specific‑Processing Protease 8; Deubiquitinating Enzyme 8; Ubiquitin Specific Protease 8; Ubiquitin Thiolest

  • AA Sequence

    PTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTSLG

  • Predicted Molecular Mass

    43.5 kDa

  • Purity

    ≥ 80%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00