VEGF-C Protein, Human (125a.a, HEK293, His)

The VEGF-C protein is a potent growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration while affecting vascular permeability. It plays a critical role in embryonic vein and lymphangiogenesis and maintains adult differentiated lymphatic endothelium. VEGF-C Protein, Human (125a.a, HEK293, His) is the recombinant human-derived VEGF-C protein, expressed by HEK293 , with C-His labeled tag.

The VEGF-CC Protein is a growth factor with significant activity in angiogenesis and endothelial cell growth, effectively stimulating their proliferation and migration while also influencing the permeability of blood vessels. This multifaceted protein is implicated in angiogenesis within both the venous and lymphatic vascular systems during embryogenesis and contributes to the maintenance of differentiated lymphatic endothelium in adults. VEGF-CC achieves these functions by binding and activating receptors KDR/VEGFR2 and FLT4/VEGFR3. Structurally, VEGF-CC exists as a homodimer, displaying a non-covalent and antiparallel arrangement. The protein's interaction with FLT4/VEGFR3 is crucial, as it is required for FLT4/VEGFR3 homodimerization and subsequent activation. These features collectively underscore the diverse roles of VEGF-CC in regulating vascular processes and highlight its significance in both developmental and adult angiogenesis.

Human

HEK293

C-His

P49767 (T103-R227)

7424  [NCBI]

Partial

TEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Approximately 23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.