VEGF120 Protein, Mouse (HEK293)

VEGF120 Protein, Mouse (HEK293) is the recombinant mouse-derived VEGF120 protein, expressed by HEK293, with tag free. The total length of VEGF120 Protein, Mouse (HEK293) is 120 a.a., with molecular weight of 18-22 kDa.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

VEGF120 Protein, Mouse (HEK293) is the recombinant mouse-derived VEGF120 protein, expressed by HEK293, with tag free. The total length of VEGF120 Protein, Mouse (HEK293) is 120 a.a., with molecular weight of 18-22 kDa.

Background

VEGF-120 is a protein involved in the induction of key genes related to hypoxia response and angiogenesis (e.g., HIF1A). It functions by protecting cells from hypoxia-mediated cell death. by similar: Participates in the induction of key genes involved in hypoxia response and angiogenesis and protects cells from hypoxia-mediated cell death.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • VEGF120 (A27-R146)
      Accession # Q00731-3/AAB22254.1
    • C-term
  • Protein Length

    Full Length of Isoform-3

  • Synonyms

    VEGFA; Vascular Endothelial Growth Factor A; VEGF; VPF; Vascular Permeability Factor; Vascular Endothelial Growth Factor A, Long Form; VEGF-A; L-VEGF; Vascular Endothelial Growth Factor A121; Vascular Endothelial Growth Factor A165; Vascular Endothelial Growth Factor; VEGFA Protein; MVCD1

  • AA Sequence

    APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR

  • Predicted Molecular Mass

    14.1 kDa

  • Molecular Weight

    Approximately 18-22 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00