VEGF120 Protein, Mouse (HEK293)
VEGF120 Protein, Mouse (HEK293) is the recombinant mouse-derived VEGF120 protein, expressed by HEK293, with tag free. The total length of VEGF120 Protein, Mouse (HEK293) is 120 a.a., with molecular weight of 18-22 kDa.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
VEGF120 Protein, Mouse (HEK293) is the recombinant mouse-derived VEGF120 protein, expressed by HEK293, with tag free. The total length of VEGF120 Protein, Mouse (HEK293) is 120 a.a., with molecular weight of 18-22 kDa.
VEGF-120 is a protein involved in the induction of key genes related to hypoxia response and angiogenesis (e.g., HIF1A). It functions by protecting cells from hypoxia-mediated cell death. by similar: Participates in the induction of key genes involved in hypoxia response and angiogenesis and protects cells from hypoxia-mediated cell death.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag Tag Free
-
Accession
AAB22254.1 (A27-R146)
-
Molecular Construction
-
N-term
-
VEGF120 (A27-R146)
Accession # AAB22254.1 -
C-term
-
-
Protein Length
Full Length of Mature VEGF120
-
Synonyms
VEGFA; Vascular Endothelial Growth Factor A; VEGF; VPF; Vascular Permeability Factor; Vascular Endothelial Growth Factor A, Long Form; VEGF-A; L-VEGF; Vascular Endothelial Growth Factor A121; Vascular Endothelial Growth Factor A165; Vascular Endothelial G
-
AA Sequence
APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR
-
Predicted Molecular Mass
14.1 kDa
-
Molecular Weight
Approximately 18-22 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
