1. Recombinant Proteins
  2. Others
  3. Vitamin D-binding protein/GC Protein, Human (His)

Vitamin D-binding protein/GC Protein, Human (His)

Cat. No.: HY-P72202
Handling Instructions Technical Support

GC protein is a multifunctional protein that promotes vitamin D transport and storage while scavenging extracellular G-actin to maintain cellular homeostasis. It enhances the chemotactic activity of C5 alpha toward neutrophils during inflammation, helps macrophage activation, and interacts with B lymphocyte and T lymphocyte membranes, indicating its involvement in the immune process. Vitamin D-binding protein/GC Protein, Human (His) is the recombinant human-derived Vitamin D-binding protein/GC protein, expressed by E. coli , with N-6*His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
20 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

GC protein is a multifunctional protein that promotes vitamin D transport and storage while scavenging extracellular G-actin to maintain cellular homeostasis. It enhances the chemotactic activity of C5 alpha toward neutrophils during inflammation, helps macrophage activation, and interacts with B lymphocyte and T lymphocyte membranes, indicating its involvement in the immune process. Vitamin D-binding protein/GC Protein, Human (His) is the recombinant human-derived Vitamin D-binding protein/GC protein, expressed by E. coli , with N-6*His labeled tag.

Background

Vitamin D-binding protein (GC Protein) is a multifunctional protein engaged in various physiological processes. It plays a pivotal role in the transport and storage of vitamin D, contributing to its systemic availability. Furthermore, GC Protein acts as a scavenger for extracellular G-actin, a crucial function in maintaining cellular homeostasis. In the context of inflammation, it enhances the chemotactic activity of C5 alpha for neutrophils, actively participating in immune responses. Additionally, GC Protein is implicated in macrophage activation, contributing to the orchestration of immune processes. Beyond its immune-related functions, GC Protein associates with membrane-bound immunoglobulin on B-lymphocytes and interacts with the IgG Fc receptor on T-lymphocyte membranes, suggesting its involvement in immune cell interactions. Notably, the interaction with LRP2 is essential for the renal uptake of GC in complex with 25-hydroxyvitamin D3, highlighting its significance in vitamin D metabolism and homeostasis.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P02774-1 (R19-L474)

Gene ID
Molecular Construction
N-term
6*His
GC (R19-L474)
Accession # P02774-1
C-term
Protein Length

Partial

Synonyms
DBP; DBP/GC; GC; Gc globulin; Gc-globulin; GRD3; Group specific component; Group specific component vitamin D binding protein; Group-specific component; hDBP; VDB; VDBG; VDBP; Vitamin D binding alpha globulin; Vitamin D-binding protein; VTDB_HUMAN
AA Sequence

RGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL

분자량

Approximately 58 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

Vitamin D-binding protein/GC Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Vitamin D-binding protein/GC Protein, Human (His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Vitamin D-binding protein/GC Protein, Human (His)
Cat. No.:
HY-P72202
수량:
MCE Japan Authorized Agent: