VSIG4 Protein, Human (HEK293, His)
Based on 1 Customer Validation
VSIG4 Protein, a phagocytic receptor, robustly inhibits T-cell proliferation and IL2 production, serving as a potent alternative complement pathway convertase inhibitor. VSIG4 Protein, Human (HEK293, His) is the recombinant human-derived VSIG4 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
VSIG4 Protein, a phagocytic receptor, robustly inhibits T-cell proliferation and IL2 production, serving as a potent alternative complement pathway convertase inhibitor. VSIG4 Protein, Human (HEK293, His) is the recombinant human-derived VSIG4 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
VSIG4 Protein serves as a phagocytic receptor and functions as a robust negative regulator of T-cell proliferation and IL2 production. Additionally, it acts as a potent inhibitor of the alternative complement pathway convertases.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human VSIG4 at 2 μg/ mL can bind Anti-VSIG4 recombinant antibody, the EC50 is 57.66 - 235.6 ng/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q9Y279-1 (R20-P283)
-
Molecular Construction
-
N-term
-
VSIG4 (R20-P283)
Accession # Q9Y279-1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
VSIG4; V-Set And Immunoglobulin Domain Containing 4; Z39IG; CRIg; Complement Receptor Of The Immunoglobulin Superfamily; V-Set And Immunoglobulin Domain-Containing Protein 4; Protein Z39Ig; Ig Superfamily Protein
-
AA Sequence
RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLP
-
Predicted Molecular Mass
30.2 kDa
-
Molecular Weight
Approximately 37-68 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
