VSTM1 Protein, Human (HEK293, His)
VSTM1 interacts with S100A10 protein, inducing the dimerization of ANXA2/p36. This suggests a regulatory role in protein phosphorylation, with ANXA2 monomer being the preferred target for tyrosine-specific kinase in vitro. The resulting heterotetramer comprises two light chains of S100A10/p11 and two heavy chains of ANXA2/p36. Furthermore, VSTM1 engages with SCN10A and TASOR, indicating its participation in diverse molecular interactions. VSTM1 Protein, Human (119a.a, HEK293, His) is the recombinant human-derived VSTM1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
VSTM1 interacts with S100A10 protein, inducing the dimerization of ANXA2/p36. This suggests a regulatory role in protein phosphorylation, with ANXA2 monomer being the preferred target for tyrosine-specific kinase in vitro. The resulting heterotetramer comprises two light chains of S100A10/p11 and two heavy chains of ANXA2/p36. Furthermore, VSTM1 engages with SCN10A and TASOR, indicating its participation in diverse molecular interactions. VSTM1 Protein, Human (119a.a, HEK293, His) is the recombinant human-derived VSTM1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
S100A10 protein induces the dimerization of ANXA2/p36, suggesting a regulatory role in protein phosphorylation, where the ANXA2 monomer is the preferred target for tyrosine-specific kinase in vitro. The protein forms a heterotetramer, consisting of two light chains of S100A10/p11 and two heavy chains of ANXA2/p36. Additionally, S100A10 interacts with SCN10A and TASOR, indicating its involvement in various molecular interactions.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q6UX27 (Y17-T135)
-
Molecular Construction
-
N-term
-
VSTM1 (Y17-T135)
Accession # Q6UX27 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
VSTM1; V-Set And Transmembrane Domain Containing 1; UNQ3033; V-Set And Transmembrane Domain-Containing Protein 1; Signal Inhibitory Receptor On Leukocytes-1; SIRL-1; V-Set And Transmembrane Domain Containing 1 Isoform D; V-Set And Transmembrane Domain Con
-
AA Sequence
YEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQEQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRT
-
Predicted Molecular Mass
14.6 kDa
-
Molecular Weight
Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
