VSTM1 Protein, Human (HEK293, Fc)
VSTM1 interacts with S100A10 protein, inducing the dimerization of ANXA2/p36. This suggests a regulatory role in protein phosphorylation, with ANXA2 monomer being the preferred target for tyrosine-specific kinase in vitro. The resulting heterotetramer comprises two light chains of S100A10/p11 and two heavy chains of ANXA2/p36. Furthermore, VSTM1 engages with SCN10A and TASOR, indicating its participation in diverse molecular interactions. VSTM1 Protein, Human (HEK293, Fc) is the recombinant human-derived VSTM1 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
VSTM1 interacts with S100A10 protein, inducing the dimerization of ANXA2/p36. This suggests a regulatory role in protein phosphorylation, with ANXA2 monomer being the preferred target for tyrosine-specific kinase in vitro. The resulting heterotetramer comprises two light chains of S100A10/p11 and two heavy chains of ANXA2/p36. Furthermore, VSTM1 engages with SCN10A and TASOR, indicating its participation in diverse molecular interactions. VSTM1 Protein, Human (HEK293, Fc) is the recombinant human-derived VSTM1 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
S100A10 protein induces the dimerization of ANXA2/p36, suggesting a regulatory role in protein phosphorylation, where the ANXA2 monomer is the preferred target for tyrosine-specific kinase in vitro. The protein forms a heterotetramer, consisting of two light chains of S100A10/p11 and two heavy chains of ANXA2/p36. Additionally, S100A10 interacts with SCN10A and TASOR, indicating its involvement in various molecular interactions.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q6UX27 (Y17-T135)
-
Molecular Construction
-
N-term
-
VSTM1 (Y17-T135)
Accession # Q6UX27 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
VSTM1; V-Set And Transmembrane Domain Containing 1; UNQ3033; V-Set And Transmembrane Domain-Containing Protein 1; Signal Inhibitory Receptor On Leukocytes-1; SIRL-1; V-Set And Transmembrane Domain Containing 1 Isoform D; V-Set And Transmembrane Domain Con
-
AA Sequence
YEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQEQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRT
-
Predicted Molecular Mass
40.6 kDa
-
Molecular Weight
Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
