VSTM1 Protein, Human (HEK293, Fc)

VSTM1 interacts with S100A10 protein, inducing the dimerization of ANXA2/p36. This suggests a regulatory role in protein phosphorylation, with ANXA2 monomer being the preferred target for tyrosine-specific kinase in vitro. The resulting heterotetramer comprises two light chains of S100A10/p11 and two heavy chains of ANXA2/p36. Furthermore, VSTM1 engages with SCN10A and TASOR, indicating its participation in diverse molecular interactions. VSTM1 Protein, Human (HEK293, Fc) is the recombinant human-derived VSTM1 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

VSTM1 interacts with S100A10 protein, inducing the dimerization of ANXA2/p36. This suggests a regulatory role in protein phosphorylation, with ANXA2 monomer being the preferred target for tyrosine-specific kinase in vitro. The resulting heterotetramer comprises two light chains of S100A10/p11 and two heavy chains of ANXA2/p36. Furthermore, VSTM1 engages with SCN10A and TASOR, indicating its participation in diverse molecular interactions. VSTM1 Protein, Human (HEK293, Fc) is the recombinant human-derived VSTM1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

S100A10 protein induces the dimerization of ANXA2/p36, suggesting a regulatory role in protein phosphorylation, where the ANXA2 monomer is the preferred target for tyrosine-specific kinase in vitro. The protein forms a heterotetramer, consisting of two light chains of S100A10/p11 and two heavy chains of ANXA2/p36. Additionally, S100A10 interacts with SCN10A and TASOR, indicating its involvement in various molecular interactions.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • VSTM1 (Y17-T135)
      Accession # Q6UX27
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    VSTM1; V-Set And Transmembrane Domain Containing 1; UNQ3033; V-Set And Transmembrane Domain-Containing Protein 1; Signal Inhibitory Receptor On Leukocytes-1; SIRL-1; V-Set And Transmembrane Domain Containing 1 Isoform D; V-Set And Transmembrane Domain Con

  • AA Sequence

    YEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQEQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRT

  • Predicted Molecular Mass

    40.6 kDa

  • Molecular Weight

    Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00