XCL2/SCM-1 beta Protein, Human (sf9, His)

XCL2 (also knowns as SCM1-β and SCYC-2) is a member of C chemokine sub-family that is highly related to XCL1. XCL2 binds and activates the G protein-coupled receptor, XCR1. XCL2 is mainly produced by activated T cells and natural killer cells^[1]. XCL2/SCM-1 beta Protein, Human (sf9, His) is produced in sf9 insect cells with a C-Terminal His-tag. It consists of 114 amino acids (M1-G114).

An alignment of the XCL1 and XCL2 amino acid sequences illustrates their high similarity. The human proteins differ at only two sequence positions, 7DK8 and 7HR8 in XCL1 and XCL2, respectively. XCL2 is constitutively expressed by unstimulated natural killer (NK) cells and to a lesser extent by inactive CD8 ⁺ T cells^[1].

Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human XCR1. The ED₅₀ for this effect is 49.31 ng/mL, corresponding to a specific activity is 2.028×10⁴ U/mg.

• 
  Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human XCR1. The ED₅₀ for this effect is 49.31 ng/mL, corresponding to a specific activity is 2.028×10⁴ U/mg.

Human

Sf9 insect cells

C-His

Q9UBD3 (M1-G114)

6846  [NCBI]

Full Length

MRLLILALLGICSLTAYIVEGVGSEVSHRRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 10% Glycerol, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Jamie C Fox, et al. Structural and agonist properties of XCL2, the other member of the C-chemokine subfamily. Cytokine. 2015 Feb;71(2):302-11.  [Content Brief]