VAL

Zabopegdutide is a glucagon and glucagon-like peptide 1 (GLP-1) receptor agonist. Zabopegdutide can be used for the study of obesity .

Compare

Please select quantity

August 31

Get Quote

View All Sizes

NOTA-MAL-Cys39-Exendin-4

Cat. No.: HY-P11945

Target:

GLP Receptor

Research Areas:

Metabolic Disease Cancer

NOTA-MAL-Cys39-Exendin-4 is an imaging agent and radiotracer precursor targeting GLP-1R. NOTA-MAL-Cys39-Exendin-4 binds specifically to GLP-1R and is rapidly cleared by the liver and spleen during the blood pool phase. NOTA-MAL-Cys39-Exendin-4 can be efficiently radiolabeled with gallium-68 to form a stable radiotracer with high radiochemical purity. NOTA-MAL-Cys39-Exendin-4 is applicable to research related to insulinomas .

Compare

Please select quantity

August 31

Get Quote

View All Sizes

[Pro3]-GIP (Rat)

Cat. No.: HY-P1433

Target:

Research Areas:

[Pro3]-GIP (Rat) is a selective GIP receptor partial agonist with a K_i of 13 nM. [Pro3]-GIP (Rat) can be used in diabetes research .

Compare

Please select quantity

August 31

Get Quote

View All Sizes

[Pro3]-GIP (mouse)

Cat. No.: HY-P1434

Target:

Research Areas:

[Pro3]-GIP (mouse) is a GIP receptor antagonist (IC₅₀: 2.6 μM). [Pro3]-GIP (mouse) improves glucose tolerance and insulin sensitivity in ob/ob mice. [Pro3]-GIP (mouse) can be used for research of type 2 diabetes .

Compare

Please select quantity

August 31

Get Quote

View All Sizes

CRF, bovine

Cat. No.: HY-P1533

CAS No.: 92307-52-3

Synonyms: Corticotropin Releasing Factor bovine

Target:

Inflammation/Immunology Endocrinology

Research Areas:

CRF, bovine is a potent agonist of CRF receptor, and displaces [ ¹²⁵I-Tyr]ovine CRF with a K_i of 3.52 nM.

Compare

Please select quantity

August 31

Get Quote

View All Sizes

Urotensin I

Cat. No.: HY-P1542

CAS No.: 83930-33-0

Synonyms: Catostomus urotensin I

Target:

Cardiovascular Disease Endocrinology

Research Areas:

Urotensin I (Catostomus urotensin I), a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC₅₀s of 11.46, 9.36 and 9.85 for human CRF₁, human CRF₂ and rat CRF_2α receptors in CHO cells, and K_is of 0.4, 1.8, and 5.7 nM for hCRF₁, rCRF_2α and mCRF_2β receptors, respectively .

Compare

Please select quantity

August 31

Get Quote

View All Sizes

Urotensin I TFA

Cat. No.: HY-P1542B

Synonyms: Catostomus urotensin I TFA

Target:

Cardiovascular Disease Endocrinology

Research Areas:

Urotensin I (Catostomus urotensin I) TFA, a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC₅₀s of 11.46, 9.36 and 9.85 for human CRF₁, human CRF₂ and rat CRF_2α receptors in CHO cells, and K_is of 0.4, 1.8, and 5.7 nM for hCRF₁, rCRF_2α and mCRF_2β receptors, respectively .

Compare

Please select quantity

August 31

Get Quote

View All Sizes

Amylin (IAPP), feline

Cat. No.: HY-P1871

CAS No.: 213779-12-5

Target:

Amylin Receptor

Research Areas:

Amylin (IAPP), feline is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline is a regulatory peptide, which inhibits insulin and glucagon secretion .

Compare

Please select quantity

August 31

Get Quote

View All Sizes

Amylin (IAPP), feline TFA

Cat. No.: HY-P1871A

Target:

Amylin Receptor

Research Areas:

Angiotensin-converting Enzyme (ACE)

Amylin (IAPP), feline TFA is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline TFA is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline TFA is a regulatory peptide, which inhibits insulin and glucagon secretion .

Compare

Please select quantity

August 31

Get Quote

View All Sizes

Human β-defensin-1

Cat. No.: HY-P2315

CAS No.: 452274-53-2

Synonyms: HβD-1

Target:

Antibiotic Bacterial

Research Areas:

Infection

Human β-defensin-1 (HβD-1) is a cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by all epithelial surfaces, but also by circulatory cells and cells of the reproductive tract. Human β-defensin-1 has antimicrobial activities against a broad-sperm bacteria .

Compare

Please select quantity

August 31

Get Quote

View All Sizes

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ

Cat. No.: HY-P3142

Target:

Research Areas:

Cardiovascular Disease

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.

Compare

Please select quantity

August 31

Get Quote

View All Sizes

[D-Ala2]-GIP (human)

Cat. No.: HY-P3247

CAS No.: 444073-04-5

Target:

Neurological Disease Metabolic Disease

Research Areas:

[D-Ala2]-GIP (human) is a GIP receptor agonist (EC₅₀ = 630 pM). [D-Ala2]-GIP (human) improves glucose tolerance. [D-Ala2]-GIP (human) shows neuroprotective activity in MPTP (HY-W114750)-induced Parkinson's disease model. [D-Ala2]-GIP (human) also improves cognitive function and hippocampal synaptic plasticity in obese diabetic rats. [D-Ala2]-GIP (human) can be used for research of type 2 diabetes, Parkinson's disease, etc

Compare

Please select quantity

August 31

Get Quote

View All Sizes

Pegloxenatide

Cat. No.: HY-P3491

CAS No.: 2420483-82-3

Synonyms: Polyethylene glycol loxenatide; PEX 168

Target:

GCGR PI3K Akt Reactive Oxygen Species (ROS) Autophagy Interleukin Related Sirtuin AMPK Apoptosis

Research Areas:

Cardiovascular Disease Metabolic Disease Inflammation/Immunology

Pegloxenatide (Polyethylene glycol loxenatide) is a long-acting glucagon-like peptide-1 receptor (GLP-1RA) agonist. Pegloxenatide has various activities such as lowering blood glucose, lowering blood lipids, improving body weight, anti-inflammation, promoting wound healing, protecting the liver, and protecting the heart. Pegloxenatide can be used in the research of type 2 diabetes and its multiple complications .

Compare

Please select quantity

August 31

Get Quote

View All Sizes

Corticotropin-releasing factor (Sheep)

Cat. No.: HY-P3538

CAS No.: 9015-71-8

Synonyms: CRH (Sheep)

Target:

Inhibitory Antibodies

Research Areas:

Neurological Disease

Corticotropin-releasing factor (CRH) (Sheep) is a brain-penetrant hypothalamic releasing factor and a peptide hormone with analgesic and arousal-inducing activity. Corticotropin-releasing factor (Sheep) mediates stress effects, including stress-induced analgesia. Corticotropin-releasing factor (Sheep) increases wakefulness, reduces slow wave sleep, alters EEG frequency content, stimulates ACTH and β-endorphin release, activates locomotor activity. Corticotropin-releasing factor (Sheep) can be used for the research of neurological disease .

Compare

Please select quantity

August 31

Get Quote

View All Sizes

Acetyl Gastric Inhibitory Peptide (human)

Cat. No.: HY-P3580

CAS No.: 299898-33-2

Synonyms: Human N-acetyl GIP

Target:

Metabolic Disease Endocrinology

Research Areas:

Acetyl Gastric Inhibitory Peptide (human) is a fatty acid derivatized analog of glucose-dependent insulinotropic polypeptide with improved antihyperglycaemic and insulinotropic properties. Acetyl Gastric Inhibitory Peptide (human) can be used for research of diabetes, insulin resistance and obesity .

Compare

Please select quantity

August 31

Get Quote

View All Sizes

Acetyl Gastric Inhibitory Peptide (human) TFA

Cat. No.: HY-P3580A

Synonyms: Human N-acetyl GIP TFA

Target:

Metabolic Disease Endocrinology

Research Areas:

Acetyl Gastric Inhibitory Peptide (human) TFA is a fatty acid derivatized analog of glucose-dependent insulinotropic polypeptide with improved antihyperglycaemic and insulinotropic properties. Acetyl Gastric Inhibitory Peptide (human) TFA can be used for research of diabetes, insulin resistance and obesity .

Compare

Please select quantity

August 31

Get Quote

View All Sizes

(Pro3) GIP, human

Cat. No.: HY-P3584

CAS No.: 299898-52-5

Synonyms: (Pro3) Gastric Inhibitory Peptide, human

Target:

Research Areas:

(Pro3) GIP, human ((Pro3) Gastric Inhibitory Peptide, human) is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, human has high binding affinity for human GIPR with K_i/ K_d values of 0.90 nM. (Pro3) GIP, human can be used for the research of obesity-related diabetes .

Compare

Please select quantity

August 31

Get Quote

View All Sizes

(Pro3) GIP, human TFA

Cat. No.: HY-P3584A

Synonyms: (Pro3) Gastric Inhibitory Peptide, human TFA

Target:

Research Areas:

(Pro3) GIP, human TFA is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, human TFA has high binding affinity for human GIPR with K_i/ K_d value of 0.90 nM. (Pro3) GIP, human TFA human can be used for the research of obesity-related diabetes .

Compare

Please select quantity

August 31

Get Quote

View All Sizes

[DPro5] Corticotropin Releasing Factor, human, rat TFA

Cat. No.: HY-P3684A

Target: