country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P5921

Copy Link Print Information

Tityustoxin-Kα

Name: Tityustoxin-Kα
Brand: MedChemExpress
SKU: HY-P5921
Availability: PreOrder

(Synonyms: TsTx-Kα)

Tityustoxin-Kα (TsTx-Kα) is an inhibitor of potassium voltage-gated channels. Tityustoxin-Kα shows a dose-dependent block of the sustained outward current in cultured hippocampal neurons .

For research use only. We do not sell to patients.

CAS No.: 152618-71-8
Formula: C₁₆₈H₂₇₅N₄₉O₄₆S₇
Molecular Weight:3941.74

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

Tityustoxin-Kα Chemical Structure

CAS No.: 152618-71-8

Size

Price

Stock

Quantity

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity

Description

Tityustoxin-Kα (TsTx-Kα) is an inhibitor of potassium voltage-gated channels. Tityustoxin-Kα shows a dose-dependent block of the sustained outward current in cultured hippocampal neurons ^[1].

Chemical Information

CAS No. 152618-71-8
Molecular Weight 3941.74
Formula C₁₆₈H₂₇₅N₄₉O₄₆S₇
Synonyms

TsTx-Kα
Sequence

Val-Phe-Ile-Asn-Ala-Lys-Cys-Arg-Gly-Ser-Pro-Glu-Cys-Leu-Pro-Lys-Cys-Lys-Glu-Ala-Ile-Gly-Lys-Ala-Ala-Gly-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Pro (Disulfide bridge: Cys7-Cys28, Cys13-Cys33, Cys17-Cys35)
Sequence Shortening

VFINAKCRGSPECLPKCKEAIGKAAGKCMNGKCKCYP (Disulfide bridge: Cys7-Cys28, Cys13-Cys33, Cys17-Cys35)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Protocols

All Cell Biology

Primary Embryonic Hippocampal Neuron Culture
Primary embryonic hippocampal neuron culture is an in vitro method in which hippocampi from embryonic rodents are dissected, enzymatically or mechanically dissociated, plated on adhesive substrates, and maintained in defined neuronal medium or in low-density sandwich/co-culture formats to support neuronal attachment, neurite extension, polarity formation, dendritic arborization, and synapse formation. The main readouts are cell survival, neuronal purity, neurite outgrowth, axon-dendrite polarization, synaptic marker development, and functional neuronal activity, assessed by phase-contrast microscopy, immunocytochemistry for neuronal/glial markers, live imaging, or electrophysiology depending on the downstream experiment.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (259 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. C U Eccles, et al. Tityustoxin-Kα, from scorpion venom, blocks voltage-gated, non-inactivating potassium current in cultured central neurons. Neuropharmacology. 1994, 33, 2. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Bioz

Keywords

MOQ

Minimum order quantity

100 mg

Get Quote In-stock

Other size

Get Quote