Tyr-α-CGRP (human) TFA
Tyr-α-CGRP (human) TFA is an N-terminally extended human α-CGRP analog. Tyr-α-CGRP (human) TFA can bind to membrane preparations from rat brain and spleen with IC50 values of 0.2 nM and 0.5 nM, respectively, and induce positive chronotropic and inotropic effects in isolated guinea pig right and left atria with EC50 values of 282 nM and 74 nM, respectively. Tyr-α-CGRP (human) TFA also inhibits contractile responses in rat vas deferens with an EC50 value of 1.9 nM.
For research use only. We do not sell to patients.
- Formula: C172H276N52O51S2.xC2HF3O2
- Molecular Weight:3952.48 (free base)
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
Description
Chemical Information
-
Molecular Weight 3952.48 (free base)
-
Formula C172H276N52O51S2.xC2HF3O2
-
Sequence
Tyr-Ala-Cys-Asp-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Val-Val-Lys-Asn-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 (disulfide bridge: Cys3-Cys8)
-
Sequence Shortening
YACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (disulfide bridge: Cys3-Cys8)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[1]. Poyner D R, et al. Pharmacological characterization of a receptor for calcitonin gene‐related peptide on rat, L6 myocytes[J]. British journal of pharmacology, 1992, 105(2): 441-447. [Content Brief]
[2]. Dennis T, et al. Structure-activity profile of calcitonin gene-related peptide in peripheral and brain tissues. Evidence for receptor multiplicity[J]. Journal of Pharmacology and Experimental Therapeutics, 1989, 251(2): 718-725. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)