country

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P5140

Copy Link Print Information

ω-Tbo-IT1

ω-Tbo-IT1 is a peptide toxin that can be isolated from the venom of Tibellus oblongus.ω-Tbo-IT1 is an inhibitor of insect calcium channel.

For research use only. We do not sell to patients.

Formula: C₁₇₁H₂₈₅N₆₁O₅₃S₉
Molecular Weight:4332.05

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

ω-Tbo-IT1 Chemical Structure

Size

Price

Stock

Quantity

Sample (0.1mg)

In-stock

(In Japan)

Apply Now

Get Quote Ask For Quote & Lead Time Consult sales personnel for more information Check price and availability Get Quote Ask For Quote & Lead Time Consult sales personnel for more information Check price and availability

Bulk Inquiry

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity

Description

ω-Tbo-IT1 is a peptide toxin that can be isolated from the venom of Tibellus oblongus.ω-Tbo-IT1 is an inhibitor of insect calcium channel^[1].

All Calcium Channel Isoforms :

Chemical Information

Molecular Weight 4332.05
Formula C₁₇₁H₂₈₅N₆₁O₅₃S₉
Sequence

Cys-Ala-Ser-Lys-Asn-Glu-Arg-Cys-Gly-Asn-Ala-Leu-Tyr-Gly-Thr-Lys-Gly-Pro-Gly-Cys-Cys-Asn-Gly-Lys-Cys-Ile-Cys-Arg-Thr-Val-Pro-Arg-Lys-Gly-Val-Asn-Ser-Cys-Arg-Cys-Met (Disulfide bridge: Cys1-Cys21; Cys8-Cys25; Cys20-Cys40; Cys27-Cys38)
Sequence Shortening

CASKNERCGNALYGTKGPGCCNGKCICRTVPRKGVNSCRCM (Disulfide bridge: Cys1-Cys21; Cys8-Cys25; Cys20-Cys40; Cys27-Cys38)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (259 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Mikov AN, et al. ω-Tbo-IT1-New Inhibitor of Insect Calcium Channels Isolated from Spider Venom. Sci Rep. 2015 Nov 27;5:17232. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Get Quote In-stock