Big Gastrin I (human) TFA
Based on 1 Customer Validation
Big Gastrin I, human (TFA) is a gastrointestinal hormone consisting of 34 amino acids. Big Gastrin I, human (TFA) can be used as a potential substance for the study of cancer, autoimmune diseases, fibrotic diseases, inflammatory diseases, neurological diseases or cardiovascular diseases.
For research use only. We do not sell to patients.
- Purity: 96.12%
- Formula: C178H252F3
- Molecular Weight:3963.21
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
-
Bioactive Compound Library Max
HY-L181
-
Bioactive Compound Library
HY-L001
-
Anti-Infection Compound Library
HY-L002
-
GPCR/G Protein Compound Library
HY-L006
-
Immunology/Inflammation Compound Library
HY-L007
-
Neuronal Signaling Compound Library
HY-L013
-
Anti-Cancer Compound Library
HY-L025
-
Anti-Cardiovascular Disease Compound Library
HY-L046
-
Neurotransmitter Receptor Compound Library
HY-L062
-
Peptide Library
HY-L105
-
Membrane Protein-targeted Compound Library
HY-L149
-
Membrane Receptor-targeted Compound Library
HY-L150
-
Peptide Compound Library
HY-L105S
-
High-Throughput Bioactive Compound Library
HY-L205
-
Lactylation Compound Library
HY-L249
Biological Activity
Big Gastrin I, human (TFA) (10 μg/mL, 6 days) inhibits 11.3% of HBV replication in HepG2 cells containing the hepatitis B virus (HBV) ayw strain genome and maintains cell viability at 88.7%[1].
Big Gastrin I, human (TFA) (10 μg/mL, 24 h) can arrest cells mainly in G0/G1 phase and induces apoptosis in human A549 cells[1].
Big Gastrin I, human (TFA) (10 μg/mL, 22 h) can inhibit 35% of cell migration in human endothelial cells (HUVEC)[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Cell Line:Human A549 cells
-
Concentration:10 μg/mL
-
Incubation Time:24 hours
-
Result:Resulted in 55.9% cells stalled in G0/G1 phase, 34.1% cells stalled in S phase and 10% cells stalled in G2/M phase.
-
Cell Line:Human A549 cells
-
Concentration:10 μg/mL
-
Incubation Time:24 hours
-
Result:Induced 1.1% cells apoptosis.
Chemical Information
-
Appearance Solid
-
Molecular Weight 3963.21
-
Formula C178H252F3
-
Color White to off-white
-
Sequence Shortening
{Glp}LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
DMSO : 25 mg/mL (6.31 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (267 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.2523 mL | 1.2616 mL | 2.5232 mL | 6.3080 mL |
| 5 mM | 0.0505 mL | 0.2523 mL | 0.5046 mL | 1.2616 mL |
Big Gastrin I (human) TFA Related Classifications
HY-P3446A Related Classifications
Powered by Bioz