2. GPCR/G Protein Neuronal Signaling
  3. Cholecystokinin Receptor
  4. Big Gastrin I (human) TFA

Big Gastrin I, human (TFA) is a gastrointestinal hormone consisting of 34 amino acids. Big Gastrin I, human (TFA) can be used as a potential substance for the study of cancer, autoimmune diseases, fibrotic diseases, inflammatory diseases, neurological diseases or cardiovascular diseases.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Big Gastrin I (human) TFA

Big Gastrin I (human) TFA Chemical Structure

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg In-stock
25 mg In-stock
50 mg In-stock
100 mg   Get quote  
200 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 Customer Validation

Big Gastrin I (human) TFA Related Antibodies

Top Publications Citing Use of Products

View All Cholecystokinin Receptor Isoform Specific Products:

View All Isoforms
CCKAR CCKBR

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Big Gastrin I, human (TFA) is a gastrointestinal hormone consisting of 34 amino acids. Big Gastrin I, human (TFA) can be used as a potential substance for the study of cancer, autoimmune diseases, fibrotic diseases, inflammatory diseases, neurological diseases or cardiovascular diseases[1].

In Vitro

Big Gastrin I, human (TFA) (10 μg/mL, 6 days) inhibits 11.3% of HBV replication in HepG2 cells containing the hepatitis B virus (HBV) ayw strain genome and maintains cell viability at 88.7%[1].
Big Gastrin I, human (TFA) (10 μg/mL, 24 h) can arrest cells mainly in G0/G1 phase and induces apoptosis in human A549 cells[1].
Big Gastrin I, human (TFA) (10 μg/mL, 22 h) can inhibit 35% of cell migration in human endothelial cells (HUVEC)[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Big Gastrin I (human) TFA Related Antibodies

Cell Cycle Analysis[1]

Cell Line: Human A549 cells
Concentration: 10 μg/mL
Incubation Time: 24 hours
Result: Resulted in 55.9% cells stalled in G0/G1 phase, 34.1% cells stalled in S phase and 10% cells stalled in G2/M phase.

Apoptosis Analysis[1]

Cell Line: Human A549 cells
Concentration: 10 μg/mL
Incubation Time: 24 hours
Result: Induced 1.1% cells apoptosis.
Molecular Weight

3963.21

Formula

C178H252F3
Appearance

Solid

Color

White to off-white

Sequence Shortening

{Glp}LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF-NH2
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

DMSO : 25 mg/mL (6.31 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2523 mL 1.2616 mL 2.5232 mL
5 mM 0.0505 mL 0.2523 mL 0.5046 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.2523 mL 1.2616 mL 2.5232 mL 6.3080 mL
5 mM 0.0505 mL 0.2523 mL 0.5046 mL 1.2616 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Big Gastrin I (human) TFA Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Big Gastrin I (human)Cholecystokinin ReceptorCCK Receptorbig gastrin Igastrinpeptideinflammatory diseasescancer neurological diseasesInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Big Gastrin I (human) TFA
Cat. No.:
HY-P3446A
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB) Italian - IT (252 KB) Korean - KR (252 KB) Portuguese - PT (252 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.