Ularitide
Ularitide (Urodilatin), natriuretic peptide, is a vasodilator. Ularitide binds to and activates renal receptors. Ularitide also regulates renal dopamine metabolism Ularitide can be used in the research of heart failure.
For research use only. We do not sell to patients.
- CAS No.: 118812-69-4
- Formula: C145H234N52O44S3
- Molecular Weight:3505.96
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
Description
In Vitro
Ularitide increases the amount of cyclic nucleotides and decreases the raise in permeability in HUVEC cells[2]. Ularitide (1 nM-1 μM, 15 min) reverses methacholine-evoked contraction in bovine bronchi[3]. Ularitide (1 μM, 0-300 s) increases cyclic GMP levels in the presence of phosphoramidon in bovine bronchi[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Female dogs with or without surgically induced chronic aortocaval fistula[1]
-
Dosage:5 and 10 pmol/kg/min
-
Administration:i.v. infusions for for 75 min, and thereafter at 10 pmol/kg/min for another 75 min.
-
Result:Increased in urine volume and sodium excretion with high-output CHF.
Clinical Trial
| NCT Number | Sponsor | Condition | Start Date |
Phase
|
|---|---|---|---|---|
| NCT01329991 | Plexxikon| | 2011-05 | PHASE1 |
Chemical Information
-
CAS No. 118812-69-4
-
Molecular Weight 3505.96
-
Formula C145H234N52O44S3
-
Synonyms
Urodilatin (human)
-
Sequence
Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge:Cys11-Cys27)
-
Sequence Shortening
TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge:Cys11-Cys27)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[2]. Korn C, et al. Comparison of the effects of ularitide acetate and other bronchorelaxing substances on the thrombin-induced permeability raise of human endothelial cell monolayers. Arzneimittelforschung. 1998 Mar;48(3):251-8. [Content Brief]
[3]. Nally JE, et al. Bronchodilator and pre-protective effects of urodilatin in bovine bronchi in vitro: comparison with atrial natriuretic peptide. Br J Pharmacol. 1995 Apr;114(7):1391-6. [Content Brief]
[4]. Valentin JP, et al. Urodilatin binds to and activates renal receptors for atrial natriuretic peptide. Hypertension. 1993 Apr;21(4):432-8. [Content Brief]
[5]. Choi MR, et al. Urodilatin regulates renal dopamine metabolism. J Nephrol. 2013 Nov-Dec;26(6):1042-8. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)