country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P5578A

Copy Link Print Information

A8SGLP-1 TFA

A8SGLP-1 TFA is an orally active GLP-1 analogue that the alanine at position 8 substituted with serine. A8SGLP-1 TFA reduces blood glucose in db/db mice without affecting its function.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Formule: C₁₅₁H₂₂₉N₄₁O₄₇.xC₂HF₃O₂
Masse moléculaire:3370.68 (free acid)

Stockage:

Please store the product under the recommended conditions in the Certificate of Analysis.

A8SGLP-1 TFA Chemical Structure

Size

Prix

Stock

Quantité

Amount: USD 0.00

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Activité biologique

Description

A8SGLP-1 TFA is an orally active GLP-1 analogue that the alanine at position 8 substituted with serine. A8SGLP-1 TFA reduces blood glucose in db/db mice without affecting its function^[1].

Chemical Information

Masse moléculaire 3370.68 (free acid)
Formule C₁₅₁H₂₂₉N₄₁O₄₇.xC₂HF₃O₂
Sequence

His-Ser-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-NH2
Sequence Shortening

HSEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2
Livraison

Room temperature in continental US; may vary elsewhere.
Stockage

Please store the product under the recommended conditions in the Certificate of Analysis.

Pureté et documentation

Select Batch:

Pureté: 99.98%

Assay: 99.98%

ee.: 99.98%

Fiche technique (263 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Instruction de manipulation (2659 KB)

Références

[1]. Hanlin Zhang, et al. Oral glucagon-like peptide 1 analogue ameliorates glucose intolerance in db/db mice. Biotechnol Lett. 2022 Oct;44(10):1149-1162. [Content Brief]

Calculators

Calculateur de molarité

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Calculateur de dilution

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

MOQ

Minimum order quantity

100 mg

Obtenir un devis En stock

Other size

Obtenir un devis