Ceratotoxin-1
Ceratotoxin-1 (CcoTx1), a peptide toxin, is an voltage-gated sodium channel subtypes inhibitor. Ceratotoxin-1 inhibits Nav1.1/β1, Nav1.2/β1, Nav1.4/β1, and Nav1.5/β1 with IC50 of 523 nM, 3 nM, 888 nM, and 323 nM, respectively. Ceratotoxin-1 also inhibits Nav1.8/β1.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Formule: C172H256N52O50S6
- Masse moléculaire:4044.58
-
Stockage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Chemical Information
- Pureté et documentation
- Références
-
Help & FAQs
Activité biologique
|
Nav1.1 523 nM (IC50) |
Nav1.2 3 nM (IC50) |
Nav1.4 888 nM (IC50) |
Nav1.5 323 nM (IC50) |
Nav1.8 |
Chemical Information
-
Masse moléculaire 4044.58
-
Formule C172H256N52O50S6
-
Synonyms
CcoTx1; β-TRTX-cm1a
-
Sequence
Asp-Cys-Leu-Gly-Trp-Phe-Lys-Ser-Cys-Asp-Pro-Lys-Asn-Asp-Lys-Cys-Cys-Lys-Asn-Tyr-Thr-Cys-Ser-Arg-Arg-Asp-Arg-Trp-Cys-Lys-Tyr-Asp-Leu-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys22;Cys16-Cys29)
-
Sequence Shortening
DCLGWFKSCDPKNDKCCKNYTCSRRDRWCKYDL-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys22;Cys16-Cys29)
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Please store the product under the recommended conditions in the Certificate of Analysis.
Pureté et documentation
Références
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Ceratotoxin-1 Related Classifications
HY-P5811 Related Classifications
Powered by Bioz