Enterocin K1
Based on 1 Customer Validation
Enterocin K1 (EntK1) is a bacteriocin. Enterocin K1 is a ribosomal synthetic peptide. Enterocin K1 specifically targets Enterococcus faecalis via the Eep protein on the bacterial membrane. Enterocin K1 displays a potent antibacterial activity against VRE. Enterocin K1 can be used for related studies of VRE infections.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Pureté: 95.25%
- CAS No.: 2764845-22-7
- Formule: C218H321N53O51S2
- Masse moléculaire:4564.34
-
Stockage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Activité biologique
Enterocin K1 has antibacterial activity against different Enterococci with MIC values ranging from 0.048 mg/mL to 1.56 mg/mL[1].
Enterocin K1 (0.01、0.1 and 1 mg/mL) shows no significant erythrocyte hemolysis is observed in human whole blood[1].
Enterocin K1 (1 mg/mL; 0-48 h) shows the inhibitory effect of it on bacteriocins after incubation in whole blood and plasma was 2-fold higher in plasma than in saline and 2-fold higher in blood than in plasma[1].
Enterocin K1 (10 μl of 1 mg/mL; 24 h) inhibits most of the bacteriocins with MIC values higher than 25 mg/ml in a cross-resistant manner in the spot-on-lawn assay[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Cell Line:bacteriocin
-
Concentration:1 mg/mL
-
Incubation Time:8, 24, 48 h
-
Result:Showed that after 8 h, the MIC of bacteriocin in saline was 0.19 mg/mL, and the MIC of bacteriocin in plasma was 0.78 mg/mL. The MIC of bacteriocin was 1.56 mg/mL in blood, 0.39 mg/mL in saline, 1.56 mg/mL in plasma, and 3.125 mg/m in blood after 48 hours.
Chemical Information
-
CAS No. 2764845-22-7
-
Appearance Solid
-
Masse moléculaire 4564.34
-
Formule C218H321N53O51S2
-
Color white
-
Synonyms
EntK1
-
Sequence
Met-Lys-Phe-Lys-Phe-Asn-Pro-Thr-Gly-Thr-Ile-Val-Lys-Lys-Leu-Thr-Gln-Tyr-Glu-Ile-Ala-Trp-Phe-Lys-Asn-Lys-His-Gly-Tyr-Tyr-Pro-Trp-Glu-Ile-Pro-Arg-Cys
-
Sequence Shortening
MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvant et solubilité
DMSO : 50 mg/mL (10.95 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Pureté et documentation
-
Fiche technique (280 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instruction de manipulation (2659 KB)
Références
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.2191 mL | 1.0954 mL | 2.1909 mL | 5.4772 mL |
| 5 mM | 0.0438 mL | 0.2191 mL | 0.4382 mL | 1.0954 mL | |
| 10 mM | 0.0219 mL | 0.1095 mL | 0.2191 mL | 0.5477 mL |