LIF Protein, Mouse

5 Cited Publications
Avis client

Based on 5 publication(s) in Google Scholar

LIF Protein, Mouse is a lymphoid factor involved in various neural and inflammatory processes such as the acute-phase reaction, tissue damage, and infection.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
  • Species: Mouse
  • Source: E. coli
  • Stockage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Activité biologique
  • Technical Parameters
  • Product Properties
  • Documentation
  • Références
  • Help & FAQs

Activité biologique

Description

LIF Protein, Mouse is a lymphoid factor involved in various neural and inflammatory processes such as the acute-phase reaction, tissue damage, and infection.

Background

Leukemia Inhibitory Factor (LIF) has been shown to possess a remarkable variety of actions. It releases calcium from bone tissue, and is the differentiation inhibitory factor preventing spontaneous differentiation in normal embryonic stem cells[1]. Leukemia inhibitory factor (LIF) is involved in both the neural and immune responses to injury. Its levels are increased in a variety of animal and human inflammatory conditions. Administration of Leukemia Inhibitory Factor can suppress inflammatory signs in some cases, for instance after intratracheal lipopolysaccharide-induced inflammation. Leukemia Inhibitory Factor also increases corticosterone levels via the hypothalamo-pituitary-adrenal axis. Exogenously added Leukemia Inhibitory Factor induces acute phase protein expression and stimulates the production of proinflammatory cytokines and monocyte chemoattractants[2]. In the hematopoietic system, LIF induces the differentiation of certain leukemic cells and the proliferation of hematopoietic stem cells, megakaryocyte progenitor cells and DA1 cells. LIF also has activity in bone remodelling, induction of the acute phase response in hepatocytes, inhibition of adipogenesis, regulation of nerve differentiation and inhibition of kidney epithelial cell differentiation[3].

Verified Bioactivity

1.The ED50 is <0.01 ng/mL as measured by M1 cells, corresponding to a specific activity of >1.0 × 108 units/mg.
2.Measured by its ability to induce IL-6 secretion by M-NFS-60 mouse cells. The ED50 for this effect is 2.407 ng/mL, corresponding to a specific activity is 4.15×105 U/mg.
3.Measured in a cell proliferation assay using C2C12 cell. The ED50 for this effect is 0.1-0.8 ng/mL.

Données de validation de MCE

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce IL-6 secretion by M-NFS-60 mouse cells.The ED50 for this effect is 2.407 ng/mL, corresponding to a specific activity is 4.15×105 U/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • LIF (S24-F203)
      Accession # P09056
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    LIF; Hepatocyte-Stimulating Factor III; LIF Interleukin 6 Family Cytokine; Differentiation-Inducing Factor; HILDA; Melanoma-Derived LPL Inhibitor; Leukemia Inhibitory Factor; Human Interleukin In DA Cells; CDF; D Factor; DIA; MLPLI; Differentiation Inhibi

  • AA Sequence

    SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF

  • Predicted Molecular Mass

    20 kDa

  • Masse moléculaire

    Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Pureté

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 150 mM NaCl, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCL, pH 8.0.
4.Lyophilized from a 0.22 μm filtered solution of PBS, 8% trehalose, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Livraison

Room temperature in continental US; may vary elsewhere.

Références

Calculators

Calculateur de reconstitution

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Calculateur de dilution

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Obtenir un devis En stock

Other size
Obtenir un devis
Please select quantity
Amount: USD 0.00