Crotamine TFA
Based on 1 Customer Validation
Crotamine TFA is a Na+ channel modulator. Crotamine is a 42 amino acid toxin cross-linked by three disulfide bridges. Crotamine has analgesic activity. Crotamine also interacts with lipid membranes and shows myonecrotic activity. Crotamine can be isolated from Crotalus durissus terrificus venom.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Reinheit : 98.42%
- Formel: C214H326N64O54S7.xC2HF3O2
- Molecular Weight:4883.73 (free base)
-
Speicherung:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biologische Aktivität
Beschreibung
Chemical Information
-
Appearance Solid
-
Molecular Weight 4883.73 (free base)
-
Formel C214H326N64O54S7.xC2HF3O2
-
Color White to off-white
-
Sequence
Tyr-Lys-Gln-Cys-His-Lys-Lys-Gly-Gly-His-Cys-Phe-Pro-Lys-Glu-Lys-Ile-Cys-Leu-Pro-Pro-Ser-Ser-Asp-Phe-Gly-Lys-Met-Asp-Cys-Arg-Trp-Arg-Trp-Lys-Cys-Cys-Lys-Lys-Gly-Ser-Gly (Disulfide bonds:Cys4-Cys36, Cys11-Cys30, Cys18-Cys37)
-
Sequence Shortening
YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG (Disulfide bonds:Cys4-Cys36, Cys11-Cys30, Cys18-Cys37)
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Lösungsmittel & Löslichkeit
In Vitro:
H2O : ≥ 100 mg/mL
* "≥" means soluble, but saturation unknown.
Reinheit & Dokumentation
-
Data Sheet (295 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Verweise
[1]. Nicastro G, et al. Solution structure of crotamine, a Na+ channel affecting toxin from Crotalus durissus terrificus venom. Eur J Biochem. 2003 May;270(9):1969-79. [Content Brief]
[2]. Kerkis I, et al. Biological versatility of crotamine--a cationic peptide from the venom of a South American rattlesnake. Expert Opin Investig Drugs. 2010 Dec;19(12):1515-25. [Content Brief]
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)